WWI: Global Conflict and the Home Front
|
|
|
- Blanche Farmer
- 5 years ago
- Views:
Transcription
1 WWI: Global Conflict and the Home Front I. Total War. A. A total war is one where a nation devoted. B. The government takes. C. Crucial supplies are to civilians so that more can be used for the war. II. The Home Front An Overview A. Mobilization & Conscription 1. of ,000,000 men by the end of men served in WWI (2,000,000 saw active combat). 4. Segregation in the AEF a. 400,000 African-Americans served in. b. 15,000 served as scouts, messengers, and snipers in non-segregated units. B. Control of Industry 1. Board Railroad Administration 4. National War Labor Board C. Financing the War 1. Total cost for the US: 2. Federal Reserve System 3. 2/3 from loans ( ) a. Heavily 4. War Revenue Bills (1917, 1918): increase in 5. Excess-profit tax D. Opportunities and Reform 1. Unemployment virtually. 2. Expansion of. 3. Close cooperation between. 4. New opportunities for groups. 5. Women a. Took over during the course of the war b. Intensified efforts for women s c. August 26, 1920: 6. a. b. E. Promoting National Unity 1. a. Forbade actions that obstructed recruitment or efforts to promote insubordination in the military. b. Ordered the Postmaster General to remove from the mail c. Fines of up to $10,000 and/or up to. 2. of , 1919 a. Schenck was mailing leaflets.
2
3
4
5
6
7
8 The Roaring 20s Video Questions 1. Inthefirstmonthofthenewdecade,the becamethelawoftheland7 wasnoillegal. 2. Liquorwasnowsoldbehindcloseddoorsinplacescalled. 3. Prohibition saimwastosweep offthecitystreetsbutnowtheywereflooded withgangstersandguns. 4. The1920swereabout theline, tradition,and boundaries. 5. ItwasinAmerica s,especially thatthe was born. 6. In1920forthefirsttimemoreAmericanslived than. 7. Thenumberof inthe1920sjumped fromthepreviousdecade. 8. Thecapitalofjazzinthe1920swasin. 9. The wasoneofthemostfamousjazzclub sand wasone ofthemostfamousperformers. 10. Thepolitical,social,andculturalactivityinHarlemcametobeknownasthe. 11. InHarlemwasbornthisideaoftheNewNegro7someonewhowas tobeblack. 12. wascenteredinthecities7business,industry,andculture. 13. Americawaselectrifiedinthe1920s7electriclights andopenedup forworkandplay. 14. ThecarwouldgiveAmericansasenseof and. 15. Bymiddecadethegovernmentwasspendingmore ontheconstruction ingovernment. 16. Roadsidesweresoondottedwiththenewphenomenon. 17. Alongwithadvertisementcametheexpansionofanewconsumerconcept7. becamethemottoofthe day.
9 18. Inthelastyearsofthedecadetheitemdesiredmostwasthe. 19. In1920,after81yearsofagitation,womenwon 20. Womenthoughttheyhadtherighttolive,notjustherfamily. 21. Themoredaringwomenofthedaywereknownas or 22. TorFAllofthesechangesoriginatedinruralsettings 23. Traditionalreligionandmodernscienceclashedinthetrialagainst intennessee 24. prosecutedthecaseinfavorofthestate. 25. defendedscopes. 26. TorFTheScopesTrialwasreportedonaninternationalscale 27. Scopeswasfound andfined 28. Changesintheworldandfearsarisingfromthatresultedinhatredfor 29. TorFTheKKKwasrestrictedtotheSouth. 30. Throughoutthedecade(20s)anestimated peoplewerelynchedbytheklan. 31. TheKlantookpoliticalcontrolof states. 32. Themostfamoussportsmanoftheagewas: 33. In1927thispilotputaviationonthefrontpage: 34. Hewasthefirsttosuccessfully: 35. TheparadedownBroadwayforLindberghwasthebiggestnationalcelebrationsince 36. AdmiralBirdsetouttoconquerthenewfrontierof 37. Thejazzsong summedupthepositiveviewpointofthe age. 38. InOctoberof investorsstartedcashinginontheir stock. 39. Morethan inpapervaluesimplyvanishedthatday
10
11
12
13
14
15 The Great Depression: Video Notes 1. ThethousandsofmenwhomarchedontheCapitolwere whowanted theirbonusforservicein 2. Thebonuswasduetobepaidin. 3. Thisgroupwascalledthe 4. WhatyeardidtheStockMarketcrash? 5. TrueorFalse:TheStockMarketcrashwastheonlymanifestationofthebadeconomy 6. WhatmajorUScompanylaidoffallofitsfullJtimeworkers? 7. Whatjarringtruthwerepeoplefacedwithwhentheygottotheirbank? 8. Howdidsomepeoplerespondtothelossoftheirsavings? 9. Beforelong ofthenation smortgageswereindefault. 10. WhodidtheAmericanpeopleblamefortheirstruggles? 11. TrueorFalse:RightbeforetheDepression,thegovernmenthadalargedegreeofcontroloverthe livesofaverageamericans 12. Whatweresomesocialprogramsthatexisttodaythatdidnotexistthen? 13. WheredidthedownJandJoutersgotoforgettheirtroubles? 14. Whatappliancecouldpeoplenotlivewithout? Ksquaremilesoffarmlandbecameknownasthe 16. Wheredidthesefarmersflee: 17. Whatdidthegovernmentfeardiscontentcouldleadto? 18. HowmanyAmericansmovedtotheSovietUniontohelpbuildcommunism? 19. Thiswasthefirsttimeinhistorythatmorepeoplewere Americathan 20. InGermanytheDepressionmadethepeoplefeelliketheyneededa togetthemoutofdepression 21. AsHerbertHoovercampaignedforpresidentin1932,hefoundthathisnamehadbecome synonymouswith. a. Shantytownswerecalled. b. Newspaperswerecalled. c. Emptypocketswere. 22. Mostpeopleweren tsurewhatrooseveltmeantwhenhepromiseda buthewas,confident,andhewasn t. 23. Rooseveltwoninthegreatest Americahadeverseenandhefaced perhapsthe everpresentedtoanamericanleader.
16 24. The4millionunemployedof1930hadturnedinto millionby1933, %ofthe Americanworkforce. 25. ThemostfamouslinefromFDR sinaugurationwas 26. The allowedpeopletofeellikefdrwasspeakingdirectlytothem. 27. Rooseveltmoveddecisivelytorestore inamerica sfinancial.treasurytorushthem dollarsinnewcurrency. a. Whentheyreopened,depositseasilyexceeded. 28. Roosevelt sfirst daysinofficebroughtthemostmassive intothelivesof theamericanpeoplethecountryhadeverknown. 29. AnexampleofRooseveltplacingAmericansonthegovernmentpayrollistheCivilian. 30. Herewasthefederalgovernmentsteppingintohelppeople.Itmaynothavebeenenough.Insome casesitdidn thelp.butsomebodywas andonehadthatfeelingthatmaybeitwas goingtowork. 31. hadthemostradicalmoodofanyyearofthegreatdepression. 32. PresidentRooseveltwasthefirstpresidenttosaythatlabor,butbusiness remained. 33. HowmanypeopleattendedthefuneralforthetwokilledstrikersinSanFrancisco? 34. WhathappenedinSanFranciscofortheremainderofthestrike? 35. Howdidthestrikeconclude? 36. In1934,thereweremorethan strikesforunionrecognition. 37. The ofsomenewdealprogramswerechallengedinthecourts. 38. WhowasFatherCharlesCoughlin,Dr.FrancisTownshend,andHueyLong? 39. LongpromisedeveryAmericana,a,anda andinreturnhe wantedabsolute. 40. Longdemonstrated fordemocraticprocesses. 41. Long sprogramwascalled. 42. WhydidHueyLongnevergetthechancetorunforpresident? 43. Howmanypeopleweregivenpublicjobs? 44. The HundredDaysbroughtaboutvisiblerecovery. 45. TheRoosevelterarevolutionizedtheperceptionof andwhatitsrole is 46. FDRwasreelectedbythe inamericanpolitics. 47. By1937thedepressionin wasover.thesecretofgermany snewprosperitywas.
17 The New Deal: Alphabet Soup Directions: Sort and define each New Deal agency, as well as outlining the goal and effectiveness of each of the 3 Rs: Bank Holiday FERA WPA FCA HOLC FHA RELIEF Goal: SSA NRA Soil Conservation Act Wagner Act (NLRB) SEC Revenue Act 1st AAA 2nd AAA PWA Glass-Steagall (FDIC) TVA NYA CCC CWA Emergency Banking Act Effective? RECOVERY Goal: Effective? REFORM Goal: Effective?
18 Directions: Fill in the following charts and answer the following questions First One Hundred Days/First New Deal Dates: Dates: The Second New Deal Which agency/agencies were the MOST effective? Why? Which agencies were job creators? Which agency/agencies were the most controversial? Why? Which agencies created infrastructure?
19 Which agency/agencies were the most significant for lasting change? Why? What happened in and why? New Deal Supporters New Deal Opponents On the back of your paper, write an introduction answering this question: Assess the validity of this statement The New Deal was not an effective response to the Great Depression.
20 APUSH NAME CH 26, Foreign Policy between the Wars 1. US foreign policy rested on three fundamental principles: 2. How did each of the following contribute to US isolationist feelings in the 1930s? a. economic depression b. disillusionment after WW1 c. Nye Committee investigation 3. What was the response of the US to each of the following? Italy invades Ethiopia (1935) Spanish Civil War ( ) Japan invades China (9/1937)
21 Panay incident (12/1937) German annexation of Austria and Czechoslovakia (8-9/1938) Nazi-Soviet pact (8/1939) German invasion of Poland (9/1939) German invasion of France/French surrender (5-6/1940) Battle of Britain ( ) German u-boat attacks begin (1940) Germany invades the USSR (6/1941) Japan invades Indochina (7/1941) Pearl Harbor attacked (12/7/1941)
The United States Enters the War Ch 23-3
The United States Enters the War Ch 23-3 The Main Idea Isolationist feeling in the United States was strong in the 1930s, but Axis aggression eventually destroyed it and pushed the United States into war.
WORLD WAR LOOMS. America Moves Towards War
WORLD WAR LOOMS America Moves Towards War Americans Cling to Isolationism Public outraged at profits of banks, arms dealers during WWI Americans become isolationists; FDR backs away from foreign policy
Document Based Questions:
Name: Class: Document Based Questions: Part A - Honors Directions: Analyze the following documents. Your answers should be as detailed and ful as possible. You will need to utilize the documents and your
World War II ( )
World War II (1939-1945) What s Essential? Causes of the War (underlying and direct) Reasons for American Neutrality (various acts/events) Reason for American entrance: Pearl Harbor Wartime goals of the
Chapter 6 Canada at War
Chapter 6 Canada at War After the end of World War I, the countries that had been at war created a treaty of peace called the Treaty of Versailles. The Treaty of Versailles Germany had to take full responsibility
Chapter 20 Section 1 Mobilizing for War. Click on a hyperlink to view the corresponding slides.
Chapter 20 Section 1 Mobilizing for War Click on a hyperlink to view the corresponding slides. Click the Speaker button to listen to the audio again. Chapter Objectives Section 1: Mobilizing for War Explain
WWII Begins. European Axis Leadership. Benito Mussolini Duce of Italy Adolf Hitler Führer of Germany b d.
WWII Begins European Axis Leadership Benito Mussolini Duce of Italy 1925 1943 b.1883 - d.1945 Adolf Hitler Führer of Germany 1934-1945 b.1889 d. 1945 Allied Leaders Winston Churchill start speech at 1:04
Test - Social Studies US History Unit 08: World War II
Test - Social Studies US History Unit 08: World War II 2014-2015 1. Which of the following best summarize the role of the United States during the Second World War? A. The United States maintained neutrality
World War II. 2010, TESCCC World History, Unit 10, Lesson 6
World War II Who Who Axis Powers: Germany Italy Japan Who Allies Powers: Britain, Soviet Union, and USA Where Two Theaters of War: Europe / North Africa Where Pacific Theater Sept. 1939 through Sept. 1945
The USA remained neutral in World War I from 1914 to Due to German violations of free trade, the USA declared war in April 1917
The USA remained neutral in World War I from 1914 to 1917 Due to German violations of free trade, the USA declared war in April 1917 After America s declaration of war in 1917, the U.S. had to mobilize
The Coming of War Chapter 19 Page 638
The Coming of War 1931-1942 Chapter 19 Page 638 The Rise of Dictators The treaty that ended World War I and the economic depression that followed contributed to the rise of dictatorships in Europe and
Review ROUND 1. 4th Nine Weeks Review
Review ROUND 1 4th Nine Weeks Review ROUND ONE 1. Leader of Germany in World War II. ROUND ONE 2. Leader of Italy in World War II. ROUND ONE 3. The strategy of giving something to avoid conflict. ROUND
War in Yemen Congress Member s Wreck CDC Director Loses Job Ten-second Trivia
Assignment 35 Thursday February 1,2018 Story War in Yemen Congress Member s Wreck CDC Director Loses Job Ten-second Trivia Now Playing: Rock a Insert Bye by Clean Bandit Student Music 1 paragraph summary
ENLISTMENT. How are these posters trying to influence Americans to enlist into the military?
ENLISTMENT How are these posters trying to influence Americans to enlist into the military? The Most Fam ous Recruitm ent Poster Selective Service Act Congress passed in 1917 to meet need for more fighting
YEARS OF WAR. Chapters 6
YEARS OF WAR Chapters 6 The Wars In Asia 1937- Second Sino Japanese War In Europe, Germany invades Poland 1 st of September 1939 Second Sino-Japanese War This war began in 1937. It was fought between China
1 Chapter 33 Answers. 3a. No. The United States did not destroy Japan s merchant marine as a result of the Battle of Midway. See page 475.
1 Chapter 33 Answers Chapter 27 Multiple-Choice Questions 1a. No. The Soviet Union, the United States, and Great Britain were allies against Nazi Germany in the Second World War. Although Roosevelt might
The War in Europe 5.2
The War in Europe 5.2 On September 1, 1939, Hitler unleashed a massive air & land attack on Poland. Britain & France immediately declared war on Germany. Canada asserting its independence declares war
SSUSH19 The student will identify the origins, major developments, and the domestic impact of World War II, especially the growth of the federal
SSUSH19 The student will identify the origins, major developments, and the domestic impact of World War II, especially the growth of the federal government. a. Explain A. Philip Randolph s proposed march
World Wars Comparison Chart
World Wars Comparison Chart Topic Similarities Differences Start of Wars -Both wars began with an action that other countries could not ignore. -In World War I, the Austro-Hungarian empire thought it could
Ch: 16-2: Japan s Pacific Campaign. Essential Question: What caused the United States to join WWII? Which was most significant, WHY?
Ch: 16-2: Japan s Pacific Campaign Essential Question: What caused the United States to join WWII? Which was most significant, WHY? Review Aug. 1939: FDR urged Hitler to settle his differences with Poland
6/1/2009. On the Battlefields
On the Battlefields By 1945: 4 th largest in the world. Coastal Patrol in the early days (many PEI soldiers) Germany s Plan: use U-Boats to cut off supply lines between North America and Europe. Canada
World War II The Pacific Theater 1. Between which what dates did the Pacific War take place? 2. What event between Japan and China did it begin with?
World War II The Pacific Theater 1. Between which what dates did the Pacific War take place? 2. What event between Japan and China did it begin with? 3. What does it end with? 4. What was the Great East
Work Period: WW II European Front Notes Video Clip WW II Pacific Front Notes Video Clip. Closing: Quiz
Standard 7.0 Demonstrate an understanding of the impact of World War II on the US and the nation s subsequent role in the world. Opening: Pages 249-250 and 253-254 in your Reading Study Guide. Work Period:
World War I. Chapter 6 Section 2 The Home Front Pages
World War I Chapter 6 Section 2 The Home Front Pages 375-381 Building Up the Military n How to increase # of American Troops from 370,000 to almost 5 million in a year? n 2 million- volunteer (Adventure-
Writing. 6 Teacher Edition. Diagnostic Series. KAMICO Instructional Media, Inc. Instructional Media, Inc.
STAAR CONNECTION Writing 6 Teacher Edition Diagnostic Series KAMICO Instructional Media, Inc. KAMICO Instructional Media, Inc. P.O. Box 1143 Salado, Texas 76571 Telephone: 254.947.7283 Fax: 254.947.7284
Bell Ringer: March 21(22), 2018
Announcements: 1: No School March 30 2: Test 4/4(5)! Review is on the Weebly! Materials: 1: Spiral/blank sheet of paper 2: Emergence of Totalitarianism paper 3: V for Vendetta Script Bell Ringer: March
Ch 25-4 The Korean War
Ch 25-4 The Korean War The Main Idea Cold War tensions finally erupted in a shooting war in 1950. The United States confronted a difficult challenge defending freedom halfway around the world. Content
How did the Second World War start?
1939-1945 After World War I Newfoundland had suffered both economic and social losses. The years between the wars saw Newfoundland suffer with heavy debts, low employment, the Great Depression and social
Summative Assessment for the Announcing World War II Unit
Summative Assessment for the Announcing World War II Unit Table of Contents Item Page Number Assessment Instructions 2 Summative Assessment for Announcing World War II 3-5 Short Answer Key 6 1 Announcing
Georgia and World War II
Georgia and World War II SS8H9 The student will describe the impact of World War II on Georgia s development economically, socially, and politically. a. Describe the impact of events leading up to American
United States reaction to foreign aggression warring Arsenal
d. United States reaction to foreign aggression i. 1935: passed Act no arms to warring nations ii. 1939: -n- policy (purpose to aid the Allies) iii. 1941: - Act --> U.S. became the Arsenal of Democracy
Nazi invasion of Poland. September 1, 1939 September 27, 1939 (Date of Polish surrender)
Total War Phases of WW2 The Second World War is usually considered to have begun with the German invasion of Poland on 3 September 1939 though one can trace the sequence of events back to the German invasion
The War in Europe and North Africa Ch 24-1
The War in Europe and North Africa Ch 24-1 The Main Idea After entering World War II, the United States focused first on the war in Europe. Content Statement Summarize how atomic weapons have changed the
George C. Marshall 1953
George C. Marshall pg. 1 of 6 George C. Marshall 1953 Two words above all others became his guide - as he underlined it years later in an address to the graduating class at his old military school - the
Pearl Harbor and the Home Front War Effort. The U.S. Enters the War
Pearl Harbor and the Home Front War Effort The U.S. Enters the War Prior to U.S. entry - Germany seen as main threat Policy was to deter Japan while building 2-ocean navy Competing Interests in the Pacific
Combatants in World War I quickly began to use total war tactics
Combatants in World War I quickly began to use total war tactics Governments committed all their nation s resources and took over industry to win the war Soldiers were drafted, the media was censored,
Unit 1-5: Reading Guide. Canada and World War II
Learning Guide for Counterpoints: Exploring Canadian Issues Unit 1-5: Reading Guide Name: / 92 Canada and World War II Resource: Counterpoints: Exploring Canadian Issues, Chapter 5 Canada Declares War
HAWAII OPERATION ATTACK ON PEARL HARBOR
HAWAII OPERATION ATTACK ON PEARL HARBOR PROPAGANDA: Attack was on Sunday, December 7, 1941 Sunday = Day off for US soldiers OVERALL: On December 7, 1941, Japan surprise attacks Pearl Harbor Japan dropped
SSUSH23 Assess the political, economic, and technological changes during the Reagan, George H.W. Bush, Clinton, George W.
SSUSH23 Assess the political, economic, and technological changes during the Reagan, George H.W. Bush, Clinton, George W. Bush, and Obama administrations. a. Analyze challenges faced by recent presidents
1. Supreme commander of Allied forces in Europe + commander of D-Day Invasion
Name Class Pd Teacher WORLD WAR II A correct and completed test review will earn you the right to complete test corrections after the test is scored IF YOU ARE ABSENT ON TEST DAY YOU ARE EXPECTED TO TAKE
U.S. Is Drawn Into the War
U.S. Is Drawn Into the War 1. What was the intent of the Japanese when they attacked Pearl Harbor on December 7, 1941? They want to destroy the American Navy. vs. Aerial Photo of Pearl Harbor Japanese
Bell Quiz: Pages
Bell Quiz: Pages 569 577 1. What did Hitler do to the U.S. three days after Pearl Harbor? 2. What system did the U.S. employ to successfully attack German U-boats? 3. Which country in the axis powers did
Key Battles of WWII. How did the Allies win the war?
Key Battles of WWII How did the Allies win the war? Battle of the Atlantic 1939-1945 (January 1942 July 1943 were decisive) Around 100,000 casualties; several thousand U-Boats destroyed. Longest continuous
CPUSH Agenda for Unit 9.5: Clicker Questions Battlefront during World War I notes Today s HW: 19.2 Unit 9 Test: Thursday, January 17
Essential Question: What was the role of the United States during World War I? CPUSH Agenda for Unit 9.5: Clicker Questions Battlefront during World War I notes Today s HW: 19.2 Unit 9 Test: Thursday,
WWI: Battlefields and Homefront
WWI: Battlefields and Homefront Schlieffen Plan -Quick sweep through France to knock the French out of the war then turn east and defeat Russia. Combatants in World War I quickly began to use total war
Timeline: Battles of the Second World War. SO WHAT? (Canadian Involvement / Significance) BATTLE: THE INVASION OF POLAND
Refer to the Student Workbook p.96-106 Complete the tables for each battle of the Second World War. You will need to consult several sections of the Student Workbook in order to find all of the information.
American Neutrality 5/6/16. American Involvement. Pearl Harbor December 7 th, Let s Listen and read FDR s speech
American Neutrality Mr. McMurray US History Roosevelt, and a large majority of Americans, thought that isolationism or neutrality was the best policy. The senselessness of WWI confirmed this belief Japanese
Sample Pages from. Leveled Texts for Social Studies: The 20th Century
Sample Pages from Leveled Texts for Social Studies: The 20th Century The following sample pages are included in this download: Table of Contents Readability Chart Sample Passage For correlations to Common
The Executive Branch: Foreign Policy
The Executive Branch: Foreign Policy for eign pol i cy noun - a government's strategy in dealing with other nations. U.S. Foreign Policy is this country s actions, words, and beliefs towards other countries.
In your spiral create 8 graphic organizers over the material provided. The graphic organizers may only have 3 spokes; therefore you will need to
In your spiral create 8 graphic organizers over the material provided. The graphic organizers may only have 3 spokes; therefore you will need to summarize/combine/rewrite the information. They may look
The US Enters The Great War
The US Enters The Great War Selective Service Act of 1917 Required all men between 21 and 30 to register for the draft Candidates were drafted through a lottery system and then either accepted or rejected
5/27/2016 CHC2P I HUNT. 2 minutes
18 CHC2P I HUNT 2016 CHC2P I HUNT 2016 19 1 CHC2P I HUNT 2016 20 September 1, 1939 Poland Germans invaded Poland using blitzkrieg tactics Britain and France declare war on Germany Canada s declaration
D-Day 6 June Mark D. Harris Colonel, US Army 06 June 2014
D-Day 6 June 1944 Mark D. Harris Colonel, US Army 06 June 2014 Axis Advance Fall of Poland (Sep 1939) Fall of Denmark and Norway (Apr 1940) Fall of the Netherlands, Belgium and France (May to Jun 1940)
AFRICAN AMERICANS IN THE MILITARY
AFRICAN AMERICANS IN THE MILITARY Did you know, there has been no war fought by or within the United States that African Americans did not participate in? Throughout American history including the arrival
The Americans (Reconstruction to the 21st Century)
The Americans (Reconstruction to the 21st Century) Chapter 17: TELESCOPING THE TIMES The United States in World War II CHAPTER OVERVIEW Soldiers abroad and Americans at home join in the effort to win World
HSC Modern History Conflict in Europe Notes
HSC Modern History Year 2016 Mark 90.00 Pages 76 Published Dec 28, 2016 HSC Modern History Conflict in Europe Notes By Patrick (98.05 ATAR) Powered by TCPDF (www.tcpdf.org) Your notes author, Patrick.
I. The Pacific Front Introduction Read the following introductory passage and answer the questions that follow.
I. The Pacific Front Introduction Read the following introductory passage and answer the questions that follow. The United States entered World War II after the attack at Pearl Harbor. There were two theaters
The Soviet Union invades Finland, occupies part of Poland, and, by threatening invasion, takes over Lithuania, Estonia, and Latvia.
For Americans, World War II began on December 7, 1941. But war had been going on for years elsewhere. For the Chinese, war began in 1931, when Japan invaded northeastern China, setting up a Japanese state
A. The United States Economic output during WWII helped turn the tide in the war.
I. Converting the Economy A. The United States Economic output during WWII helped turn the tide in the war. 1. US was twice as productive as Germany and five times as that of Japan. 2. Success was due
Create the following chart on a sheet of paper and fill in each section appropriately:
Create the following chart on a sheet of paper and fill in each section appropriately: 1. Germany Country Leader Ideology (government style) 2. Italy 3. Japan 4. Russia After reviewing each country s ideology,
Entrance of the United States into World War II was Imminent, Regardless of Pearl Harbor BY ALEXANDRA RUTKOWSKI
Entrance of the United States into World War II was Imminent, Regardless of Pearl Harbor BY ALEXANDRA RUTKOWSKI General Background Kellogg-Briand Pact signed on August 27, 1928 Outlawed war as an instrument
A. True or False Where the statement is true, mark T. Where it is false, mark F, and correct it in the space immediately below.
AP U.S. History Mr. Mercado Chapter 35 America in World War II, 1939-1945 Name A. True or False Where the statement is true, mark T. Where it is false, mark F, and correct it in the space immediately below.
THE UNITED STATES IN WORLD WAR II Europe
THE UNITED STATES IN WORLD WAR II Europe AMERICA TURNS THE TIDE SECTION 1: MOBILIZING FOR DEFENSE After Japan attacked Pearl Harbor, they thought America would avoid further conflict with them The Japan
Mobilization at Home. Economic Conversion. A Nation at War. Pearl Harbor ended any debate over intervention.
A Nation at War Mobilization at Home Pearl Harbor ended any debate over intervention. Economic Conversion Due to FDR s foresight, the economy had already begun to gear up for war production through the
World War II Ends Ch 24-5
World War II Ends Ch 24-5 The Main Idea While the Allies completed the defeat of the Axis Powers on the battlefield, Allied leaders were making plans for the postwar world. Content Statement Summarize
Admiral Isoroku Yamamoto Admiral Chester Nimitz
The United States in World War II "The fate of the Empire rests on this enterprise every man must devote himself totally to the task in hand." Admiral Isoroku Yamamoto - Commander in Chief of the Japanese
The First Years of World War II
The First Years of World War II ON THE GROUND IN THE AIR ON THE SEA We know that Germany invaded Poland on September 1, 1939, and that both Britain and France declared war on Germany on September 3, 1939.
3/6/2017. Prelude to War. America Enters World War II. The Road to War Establishing Alliances Establishing Priorities Where to Strike
Prelude to War America Enters World War II 1 The Road to War Establishing Alliances Establishing Priorities Where to Strike 2 Pro Nazi German American Groups The German American Bund Recruit sympathetic
SSUSH19 Examine the origins, major developments, and the domestic impact of World War II, including the growth of the federal government. a.
SSUSH19 Examine the origins, major developments, and the domestic impact of World War II, including the growth of the federal government. a. Investigate the origins of U.S. involvement in the war including
Guided Reading Activity 21-1
Guided Reading Activity 21-1 DIRECTIONS: Recording Who, What, When, Where, Why and How Read the section and answer the questions below Refer to your textbook to write the answers 1 What did Winston Churchill
US World War II And Korean War Field Fortifications (Fortress) By Gordon Rottman READ ONLINE
US World War II And Korean War Field Fortifications 1941-53 (Fortress) By Gordon Rottman READ ONLINE If searched for the book US World War II and Korean War Field Fortifications 1941-53 (Fortress) by Gordon
THE AMERICAN JOURNEY A HISTORY OF THE UNITED STATES
THE AMERICAN JOURNEY A HISTORY OF THE UNITED STATES Brief Sixth Edition Chapter 26 World War II 1939-1945 World War II 1939-1945 The Dilemmas of Neutrality Holding the Line Mobilizing for Victory The Home
Preparing for War. 300,000 women fought Worked for the Women s Army Corps (WAC) Drivers Clerks Mechanics Army and Navy Nurse Corps
Preparing for War Selective Service Act All men between the ages of 18 and 38 had to register for military services. 300,000 Mexican Americans fought 1 million African Americans fought 300,000 women fought
CHAPTER 24 THE UNITED STATES IN WORLD WAR II The Big Picture: The United States succeeded along with the Allies to defeat the Axis powers in Europe
CHAPTER 24 THE UNITED STATES IN WORLD WAR II The Big Picture: The United States succeeded along with the Allies to defeat the Axis powers in Europe and the Pacific. Yet the cost of victory and the discovery
Turn: Winter Economic Trend 0. Hungarian-Czech animosity. The Axis must support one side; Russia or the Allies the other EAI: +1
Turn: Winter 1937 Random events Economic Climate European Aggression Index Support Effects Factories Income Expenditures Activity Counters Mobilizations Axis and Allied Forces Balance of Power Spy Rings
SS.7.C.4.3 Describe examples of how the United States has dealt with international conflicts.
SS.7.C.4.3 Benchmark Clarification 1: Students will identify specific examples of international conflicts in which the United States has been involved. The United States Constitution grants specific powers
European Theatre. Videos
European Theatre Videos What do you SEE? THINK? WONDER? Now, what do you THINK? WONDER? 'Fallen 9000' Project: Thousands Of Stenciled Bodies In The Sand Serve As Poignant D-Day Tribute An ambitious installation
DBQ 20: THE COLD WAR BEGINS
Historical Context Between 1945 and 1950, the wartime alliance between the United States and the Soviet Union broke down. The Cold War began. For the next forty years, relations between the two superpowers
The World at War
America's History James A. Henretta, Rebecca Edwards, Robert O. Self, The World at War 1937-1945 LEARNING OBJECTIVES After we have covered this chapter, you should be able to answer the following questions:
SSUSH19: The student will identify the origins, major developments, and the domestic impact of World War ll, especially the growth of the federal
SSUSH19: The student will identify the origins, major developments, and the domestic impact of World War ll, especially the growth of the federal government. c. Explain major events; include the lend-lease
The United States in World War II
The United States in World War II The U.S. helps lead the Allies to victory in World War II, but only after dropping atomic bombs on Japan. American veterans discover new economic opportunities, but also
SS.7.C.4.3 International. Conflicts
SS.7.C.4.3 International Conflicts WORLD WAR I 1914-1918 (US JOINED IN 1915) BRAINPOP: HTTPS://WWW.BRAINPOP.COM/SOCIALSTUDIES/USHISTORY/WORLDWARI/ Why did the U.S. become involved? On May 7, 1915 the British
Explain why Japan decided to attack Pearl Harbor, and describe the attack itself.
Objectives Explain why Japan decided to attack Pearl Harbor, and describe the attack itself. Outline how the United States mobilized for war after the attack on Pearl Harbor. Summarize the course of the
The. Most Devastating War Battles
The 7 Most Devastating War Battles Prepared By: Kalon Jonasson, Ashley Rechik, April Spring, Trisha Marteinsson, Yasmin Busuttil, Laura Oddleifsson, Alicia Vernaus The Vietnam War took place from 1957
Discussion of each topic will centre on a distinctive set of problems:
FROM SARAJEVO TO BAGHDAD: KEY DECISIONS ON WAR AND PEACE, 1914-2003 (IR106) Course duration: 54 hours lecture and class time (Over three weeks) Summer School Programme Area: International Relations, Government
American and World War II
American and World War II Chapter 20; Guided Notes Section 1: I. Converting the Economy (pages 612 613) A. The United States output during World War II was as as and times that of. This turned the tide
You have a QUIZ TODAY! Quiz REVIEW!
You have a QUIZ TODAY! Quiz REVIEW! 1. What happened on Bloody Sunday in Russia? 2. In the 1920 s & 1930 s, the rise of Totalitarian governments in Europe was due to.? 3. What is the main difference between
1 Create an episode map on the Civil Rights Movement in the U.S.A.
WARM UP 1 Create an episode map on the Civil Rights Movement in the U.S.A. 2 You have 15 minutes to do this assignment with one another before we review as a class 3 You will also turn in the JFK/LBJ Episode
World War II. Post Pearl Harbor
World War II Post Pearl Harbor Pearl Harbor Japanese negotiators agreed to meet with US diplomats. While they met, the Japanese decided to send a fleet to Pearl Harbor to destroy the US Pacific fleet.
International Council of Nurses Nurse Refugee Files
MC 112 Finding aid prepared by Center staff, updated by Bethany Myers. Last updated on February 11, 2014. University of Pennsylvania, Barbara Bates Center for the Study of The History of Nursing Table
Chapter 27, Section 5: The Cold War Ends
Chapter 27, Section 5: The Cold War Ends Main Idea: The Cold War dominated relations between the superpowers until the breakup of the USSR in 1991 ended the Cold War. A. Changes in American Foreign Policy
D Domicile ; H Hospital ; N Non-Domicile ; R Resistance
Sub-section: ALLIED COUNTRIES 15 Mar 2017 1 1.0 PURPOSE Allied Veterans who have wartime service with the Allied Forces who also lived in Canada for at least 10 years, or lived in Canada prior to enlisting
6-7: ENDING THE SECOND WORLD WAR
6-7: ENDING THE SECOND WORLD WAR I. Overview A. Americans viewed the war as a fight for the survival of freedom and democracy against fascist and militarist ideologies. This perspective was later reinforced
The United States in World War II
The United States in World War II The U.S. helps lead the Allies to victory in World War II, but only after dropping atomic bombs on Japan. American veterans discover new economic opportunities, but also
2/7/2017 Bombing of Dresden World War II HISTORY.com BOMBING OF DRESDEN
BOMBING OF DRESDEN From February 13 to February 15, 1945, during the nal months of World War II (1939-45), Allied forces bombed the historic city of Dresden, located in eastern Germany. The bombing was
Chapter 17: Foreign Policy and National Defense Section 3
Chapter 17: Foreign Policy and National Defense Section 3 Objectives 1. Summarize American foreign policy from independence through World War I. 2. Show how the two World Wars affected America s traditional
WORLD WAR II 2865 U59-2
No. 21 World War II WORLD WAR II On Sunday, December 7, 1941, Pearl Harbor, a United States military base in Hawaii, was attacked by Japanese air forces. This surprise attack led to the United States'
World War II - Final
World War II - Final Attack on Midway Island An attack on Midway Island the last American base in the North Pacific west of Hawaii was planned to lure the American fleet into battle to be destroyed by
3/19/2013. Before War Begins. The United States in World War II. Isolation vs. Internationalism. War Debts and Reparations. War Debts and Reparations
Before War Begins The United States in World War II A look at issues leading to War Isolation vs. Internationalism America seemed to favor isolationism since WWI America could not stay isolated international
3/23/2011. Before War Begins. in World War II. Isolation vs. Internationalism. War Debts and Reparations. War Debts and Reparations
Before War Begins The United States in World War II A look at issues leading to War Isolation vs. Internationalism America seemed to favor isolationism since WWI America could not stay isolated international