THE UNIVERSITY OF TEXAS AT AUSTIN
|
|
- Roy Copeland
- 6 years ago
- Views:
Transcription
1 THE UNIVERSITY OF TEXAS AT AUSTIN ANNUAL FINANCIAL REPORT (WITH DETAILED SUPPORTIVE SCHEDULES) UNAUDITED FISCAL YEAR ENDED AUGUST 31, 2013 The University of Texas at Arlington + The University of Texas at Austin + The University of Texas at Brownsville The University of Texas at Dallas + The University of Texas at El Paso + The University of Texas-Pan American + The University of Texas of the Permian Basin The University of Texas at San Antonio + The University of Texas at Tyler + The University of Texas Southwestern Medical Center + The University of Texas Medical Branch at Galveston The University of Texas Health Science Center at Houston The University of Texas Health Science Center at San Antonio + The University of Texas M. D. Anderson Cancer Center + The University of Texas Health Science Center at Tyler + The University of Texas System Administration
2 THE UNIVERSITY OF TEXAS AT AUSTIN FINANCIAL STATEMENTS (WITH DETAILED SUPPORTIVE SCHEDULES) Presented herein are the financial statements with detailed supportive schedules for The University of Texas at Austin for the year ended August 31,2013. These Statements and detailed supportive schedules have been prepared in compliance with applicable State statutes, Governmental Accounting Standards Board pronouncements, and the Texas Comptroller of Public Accounts' Annual Financial Reporting Requirements. This "detailed internal report" supplements the consolidated published Annual Financial Report of The University of Texas System and is intended to be for limited distribution primarily to financial and academic officers of the University who need access to the details included herein. It also provides an historical record of transactions relating to this particular institution. The Annual Financial Report for public distribution for The University of Texas System includes primary statements on a consolidated System-wide basis, including footnotes and Managements' Discussion and Analysis.
3
4 THE UNIVERSITY OF TEXAS SYSTEM BOARD OF REGENTS As of August 31, 2013 Officers Paul L. Foster, Chairman Wm. Eugene "Gene" Powell, Vice Chairman R. Steven "Steve" Hicks, Vice Chairman Francie A. Frederick, General Counsel to the Board of Regents Members Terms scheduled to expire February 1, 2015* R. Steven "Steve" Hicks Wm. Eugene "Gene" Powell Robert L. Stillwell Austin San Antonio Houston Terms scheduled to expire February 1, 2017* Alex M. Granberg Wallace L. Hall, Jr. Brenda Pejovich Austin Dallas Dallas Terms scheduled to expire February 1, 2019* Ernest Aliseda Jeffery D. Hildebrand Paul L. Foster McAllen Houston El Paso Term scheduled to expire May 31, 2014* Nash M. Horne (Student Regent) Austin *Each Regent's term expires when a successor has been appointed, qualified, and taken the oath of office. The Student Regent serves a one-year term.
5
6 THE UNIVERSITY OF TEXAS SYSTEM SENIOR ADMINISTRATIVE OFFICIALS As of August 31, 2013 Francisco G. Cigarroa, M.D. Scott C. Kelley Pedro Reyes Kenneth I. Shine M.D. Daniel H. Sharphorn Barry McBee Randa S. Safady William H. Shute Amy Shaw Thomas Stephanie A. Bond Huie Patricia D. Hum Bruce E. Zimmerman Chancellor Executive Vice Chancellor for Business Affairs Executive Vice Chancellor for Academic Affairs Executive Vice Chancellor for Health Affairs Vice Chancellor and General Counsel Vice Chancellor and Chief Governmental Relations Officer Vice Chancellor for External Relations Vice Chancellor for Federal Relations Vice Chancellor and Counsel for Health Affairs Vice Chancellor for Strategic Initiatives Vice Chancellor for Research and Innovation Chief Executive Officer and Chief Investment Officer- UTIMCO THE UNIVERSITY OF TEXAS AT AUSTIN SENIOR ADMINISTRATIVE OFFICIALS As of August 31, 2013 William Powers Jr. Charles A. Roeckle Nancy Brazzil Juan M. Sanchez Gage Paine Patricia C. Ohlendorf Geoff Leavenworth Patricia L. Clubb David Onion Julie Hooper John McCall Gregory J. Vincent Brad Englert Kevin P. Hegarty Mary E. Knight Michael W. Vandervort Greg Fenves Janet Ellzey David Laude Harrison Keller Fred Heath William M. Sage Robert Messing Neal E. Armstrong Daniel T. Slesnick Kedra lshop Shelby Stanfield Judith Langlois President Deputy to the President Deputy to the President Vice President for Research Vice President for Student Affairs Vice President for Legal Affairs Chief Communications Officer Vice President for University Operations Associate Vice President for Development Associate Vice President for Development Associate Vice President for Development Vice President for Diversity and Community Engagement Associate Vice President and Chief Information Officer Vice President and Chief Financial Officer Associate Vice President and Budget Director Director of Internal Audit Executive Vice President and Provost Vice Provost for International Programs Sr. Vice Provost for Enrollment and Graduation Management Vice Provost for Higher Education Policy and Research Vice Provost and Director of University of Texas Libraries Vice Provost for Health Affairs Vice Provost for Biomedical Sciences Vice Provost for Institutional Accreditation Sr. Vice Provost for Resource Management Vice Provost and Director of Admissions Vice Provost and Registrar Vice Provost and Dean of Graduate Studies
7
8 TABLE OF CONTENTS THE UNIVERSITY OF TEXAS AT AUSTIN PRIMARY STATEMENTS Exhibit A Exhibit B Exhibit C Exhibit D Balance Sheet Statement of Revenues, Expenses and Changes in Net Position... 4 Statement of Cash Flows... 6 Statement of Method of Financing -All Funds... 7 SUPPORTING SCHEDULES Schedule A-1 Schedule A-3a Schedule B-1 Schedule B-2 Schedule B-2A Schedule B-3 Schedule B-4 Schedule B-6a Schedule B-7 Schedule of Cash and Cash Equivalents and Investments Schedule of Legislative Appropriations Schedule of E&G Funds- Summary of Operations Schedule of Designated Funds- Summary of Operations Schedule of Changes in Fund Balances Unrestricted Current Funds- Designated Funds- Service Departments Schedule of Changes in Fund Balances Unrestricted Current Funds- Auxiliary Enterprise Funds Schedule of Restricted Expendable Funds- Summary of Operations Schedule of Changes in Fund Balances- Endowment and Similar Funds- (Other than State) Schedule of Changes in Fund Balances- Annuity and Life Income Funds Schedule B-8 Schedule B-11 Schedule B-13 Schedule C-1 Schedule C-2 Summary of C-2 Schedule 1A Schedule of Changes in Fund Balances- Unexpended Plant Funds Schedule of Changes in Investment in Plant Schedule of Transfers Schedule of Current Funds Revenue Schedule of Expenses by Object and Fund Group Expense Classification Summary Schedule of Expenditures of Federal Awards Schedule 1B Schedule of Expenditures of State Awards
9 TABLE OF CONTENTS (CONTINUED) THE UNIVERSITY OF TEXAS AT AUSTIN SUPPLEMENTAL SCHEDULES Schedule S-4a Supplement Schedule S-8 Recap Schedule S-11 a Schedule S-11 b Schedule S-11 c Schedule S-11 d Schedule S-11 e Schedule S-11f Schedule S-11 g Schedule of Changes in Fund Balances - Restricted Current Funds - Federal Agencies Schedule of Changes in Fund Balance- Unexpended Plant Funds Schedule of Changes in Investment in Plant- Land Schedule of Changes in Investment in Plant- Buildings Schedule of Changes in Investment in Plant -Facilities and Other Improvements Schedule of Changes in Investment in Plant- Equipment Schedule of Changes in Investment in Plant- Construction in Progress Schedule of Changes in Investment in Plant- Infrastructure Schedule of Changes in Investment in Plant- Intangible Assets
10 PRIMARY STATEMENTS
11 2 The University oft exas at Austin Exhibit A Statement of Net Position As of August 31,2013 Educational and Auxiliary Restricted General Designated Enterprises Expendable Loan Funds ASSETS AND DEFERRED OUTFLOWS Current Assets: Cash & Cash Equivalents $ 39,012, ,955, ,728, Restricted Cash & Cash Equivalents 78,785, ,146, Balance in State Appropriations 1,421, Accounts Receivable, Net: Federal (allow. $0.00 in 2013 & $0.00 in 2012) 66,779, Other lntergov. (allow. $0.00 in 2013 & $0.00 in 2012) 6,505, Student (allow. $1,035, in 2013 & $1,425, in 2012) 11,662, , 134, ,685, Interest and Dividend Receivables 218, ,278, , , ,740, Contributions (allow. $1,915, in 2013 & $2,691, in 2012) 45,037, Other (allow. $398, in 2013 & $512, in 2012) 3,757, ,189, ,581, ,734, , Due From Other Funds Due From System Administration 203,067, , ,827, Due From Other Institutions 61, Due From Other Agencies 180, ,775, Inventories 4,104, ,283, Loans & Contracts (allow. $0.00 in 2013 & $0.00 in 2012) 9,030, Other Current Assets Total Current Assets 278,013, ,323, ,192, ,920, ,152, Noncurrent Assets: Restricted Investments 271,444, ,389, Loans & Contracts (allow. $15,929, in 2013 & $15,525, in 2012) 42,931, Funds Held by System Administration (Restricted) Contributions Rec. (allow. $ in 2013 & $ in 2012) 78,039, Unrestricted Investments 70,671, ,703, ,871, Other Noncurrent Assets Gross Capital/Intangible Assets Accumulated Depreciation/Amortization Total Noncurrent Assets 70,671, ,703, ,871, ,484, ,321, Total Assets 348,684, ,027, ,064, ,404, ,473, Total Assets and Deferred Outflows 348,684, ,027, ,064, ,404, ,473, LIABILITIES AND DEFERRED INFLOWS Current Liabilities: Accounts Payable and Accrued Liabilities 16,982, ,277, ,040, Salaries Payable 20,586, ,958, ,888, ,288, Due To Other Funds 31,538, Due To System Administration 16,730, Due To Other Institutions 333, Due To Other State Agencies 441, Unearned Revenue 6,719, ,146, ,460, ,648, Employees' Compensable Leave- Current Portion 8,068, ,030, ,952, ,430, Notes, Loans, and Leases Payable Payable From Restricted Assets 13,350, , Other Current Liabilities 1 419, , ( ) (11.50) Total Current Liabilities 102,045, ,699, ,506, ,491, , Noncurrent Liabilities: Employees' Compensable Leave 4, 923, ,003, ,411, , Assets Held for Others Liability to Beneficiaries Notes, Loans, and Leases Payable Other Noncurrent Liabilities Total Noncurrent Liabilities 4,923, ,065, ,411, , Total Liabilities 106,969, ,764, ,918, ,364, , Total Liabilities and Deferred Inflows 1 06,969, ,764, ,918, ,364, , NET POSITION Net Investment in Capital Assets Restricted for: Nonexpendable Permanent Health, True Endowments, and Annuities Expendable Capital Projects Funds Functioning as Endowment (Restricted) Other Expendable 422,040, ,850, Unrestricted , Total Net Position $ 241,715, ,262, ,145, ,040, ,850,819.56
12 3 Endowment and Similar Funds- Other Annuity and Life Unexpended Plant Than State Income Funds Funds Investment in Plant Agency Funds Current Year Totals Restated Prior Year Totals 26,171, ,828, ,867, ,760, ,421, ,836, ,191, ,975, , , ,538, ,239, , ,159, ,585, ,779, ,505, ,483, ,414, ,037, ,238, ' 538, ,233, , ,956, ,388, ,030, ,347, ,823, ,586, ,267, ,717, ,797, ,407, ,018, ,274, ,077, ,164, ,888, ,017,567, ,005,214, ,179, ,181, ,020, ,386, ,416,159, (2 591, ) 3,005,214, ,179, ,020, ,825,153, ,567, ,005,214, ,179, ,180, ,825,153, ,152, ,005,214, ,179, ,180, ,825,153, ,152, ,014, ,931, ,019,393, ,039, ,266, ,386, ,416,159, ,818, ,205, ,868,359, ,007, ,230, ,386, ,193,436, ( ) ( ,931.45) 7,040,187, ,689,350, ,939,534, ,706,918, ,939,534, ,706,918, ,079, ,396, , , , ,079, ,396, , ,379, ,650, ,721, ,784, ,538, ,018, ,730, ,648, , , , ,974, ,595, ,481, ,082, ,396, ,350, ,634, ,105, (125, ) ,507, ,780, ,495, ,079, ,490, ,495, ,079, ,490, , ,495, ,079, ,476, ,152, , ,495, ,079, ,476, ,152, ,212, ,908, ,490, ,526, ,495, ,966, ,079, ,427, ,339, ,296, ,846, ,077, ,846, ,077, ,803,676, ,803,676, ,825,564, ,645,937, ,684, (1,922,294.03) 164,286, '149, 131, , 005,21 0, ,684, ,101, ,803,676, ,653,621, ,609,411, (1,922,294.03) 35,241 ' ,286, ,201, ,645,022, ,531,570, ,171,687, ,938,840,778.21
13 4 The University of Texas at Austin Exhibit B Statement of Revenues, Expenses, and Changes in Net Position For the Year Ended August 31, 2013 Endowment and Educational and Restricted Similar Funds- General Designated Auxiliary Enterprises Expendable Loan Funds Other Than State Operating Revenues: Student Tuition and Fees $ 118,695, ,537, ,674, Discounts and Allowances (24,474,741.07) (1 06,055,443.02) (8,228,037.60) Federal Sponsored Programs 79,476, ,198, Federal Sponsored Programs Pass-Through from State Agencies (1,500.00) 2,487, ,311, State Sponsored Programs Pass-Through from State Agencies 37,577, ,383, ,156, Local Sponsored Programs 884, ,880, Private Sponsored Programs 11,669, ,811, Sales and Services of Educational Activities 81, ,715, ,939, Discounts and Allowances Sales and Services of Educational Activities (61,800.19) Auxiliary Enterprises 267,467, Discounts and Allowances Auxiliary Enterprises (13,385,737.79) Other Operating Revenues 137, ,430, , Total Operating Revenues 132,014, ,468, ,528, ,298, , Operating Expenses: Instruction 404,784, ,769, ,431, Research 46,727, ,985, ,039, Public Service 1,969, ,456, ,168, Academic Support 48,522, ,902, ,251, Student Services 18,390, ,532, ,127, , Institutional Support 51,920, ,397, ,728, Operations and Maintenance of Plant 1 '158, ,420, , Scholarships and Fellowships 53,431, ,484, ,846, Auxiliary Enterprises 241,765, ,878, Depreciation and Amortization Total Operating Expenses 626,905, ,949, ,765, ,475, , Operating Income (Loss) (494,891 '176.18) 118,518, ,763, (167,176,985.94) 6, Nonoperating Revenues (Expenses): State Appropriations 292,300, Federal Nonexchange Sponsored Programs 56, ,799, Federal Nonexchange Pass-Through State Nonexchange Pass-Through Gift Contributions for Operations 117,557, Investment Income 2,373, ,566, ,435, ,682, , (54,031.07) Net Increase (Decrease) in Fair Value of Investments 580, ,212, ,723, ,310, , ,687, Interest Expense on Capital Asset Financings (1,277,137.00) Gain (Loss) on Sale of Capital Assets (169,960.89) Other Nonoperating Revenues 163, Other Nonoperating (Expenses) (99,579.57) (13,629.08) (68,038.20) Net Nonoperating Revenues (Expenses) 295,254, ,729, ,145, ,004, , ,633, lncome/(loss) Before Other Revenue, Expenses, Gains/(Losses), and Transfers (199,636,404.96) 174,248, ,908, ,827, , ,633, Gifts and Sponsored Programs for Capital Acquisitions 42,243, Additions to Permanent Endowments I Annuities 42,707, Reclass from/(to) Other Institutions Capital Asset Purchases (6,670,820.32) (9, 118,472.42) (617,870.58) (62,107,146.05) Transactions Between Funds 251, (249,999.88) (1,258,568.18) Transfers Between Institutions & System, Debt Service- Mandatory (15,388, ) (35,407,460.55) (34,369,142.88) (9, 961, ) Transfers Between Institutions & System Admin.- Non manljatory 215,097, , (380,979.17) Transfers From Other State Agencies Transfers to Other State Agencies (185,276.00) (7,562,726.20) Legislative Appropriations Lapsed Transfers Between Funds 22,248, (36,258,547.83) (5,514,463.18) (97,646,990.01) 47, ,097, Change in Net Position 15,465, ,716, ,156, ,716, , ,438, Beginning Net Position 226,250, ,546, ,988, ,324, ,992, ,853,771, Ending Net Position $ 241,715, ,262, ' 145, ,040, ,850, ,005,210, ~~, ~-~
14 5 Restated Annuity and Life Unexpended Plant Current Year PriorY ear Income Funds Funds Investment in Plant Totals Totals 633,906, ,057, (138,758,221.69) (128,857,089.04) 388,674, ,652, ,798, ,552, ,117, ,491, ,765, ,671, ,480, ,486, ,736, ,673, (61,800.19) (51,236.61) 267, ,224, (13,385,737.79) (12,348,706.26) 8,193, ,877, , , ,491,431, ,985, ,856, ,752, ,422, ,594, ,002, ,676, ,252, ,669, ,805, ,046, ,128, ,411, ,995, ,544, ,763, ,486, ,643, ,786, ,207, ,207, ,336, ,411, ,207, , , ,249,621, (41,411,372.06) (292,207,747.00) (828,399,024.21) (758, 189,489.97) 292,300, ,350, ,856, ,640, , ,557, ,694, , ,648, ,856, ,240, (285,911.36) 3,049, ,517, (61,806,017.28) (1,277, ) (1,314,880.00) (4,948,614.42) (5,118,575.31) (6,700,141.82) 14,136, ,300, ,584, (300,802.78) (43, 144,908.52) (43,626,958.15) (23,381,978.52) 52, ,697, (33,956,871.82) 759,365, ,326, , (35,713, ) (326, 164,618.82) (69,033,578.39) (211,862, ) 67,845, ,088, ,812, , ,765, ,757, ,041, ,041, ,692, (153,389,979.82) 231,904, (200,000.00) 1,456, (1,442,339.85) (96,568,343.65) (92,447,798.48) 20,950, ,230, ,601, ,074, ,074, ,730, (1,003,718.05) (8,751,720.25) (7,578,807.59) (43,333.85) 100,069, , (55,684,206.08) (21,887,181.71) 232,846, ,704, ,617, ,785, ,825,564, ,938,840, ,806,136, ,684, ,101, ,803,676, ,171,687, ,938,840,778.21
15 6 The University of Texas at Austin EXHIBIT C- STATEMENT OF CASH FLOWS For the Year Ended August 31, 2013 Cash Flows from Operating Activities: Proceeds from Tuition and Fees Proceeds from Sponsored Programs Proceeds from Auxiliaries Proceeds from Other Revenues Payments to Suppliers Payments to Employees Payments for Loans Provided Proceeds from Loan Programs Net Cash Provided (Used) by Operating Activities Current Year Totals 493,387, ,195, ,362, ,615, (748, 194,360.57) (1,349,572,711.65) (33,440,050.27) (514,690, ) Prior Year Totals 478,251, ,269, ,380, ,403, (719,339,754.34) (1,276,901,407.21) (34,699,022.24) (485,050, ) Cash Flows from Noncapital Financing Activities: Proceeds from State Appropriations Proceeds from Operating Gifts Proceeds from Private Gifts for Endowment and Annuity Life Purposes Proceeds from Other Nonoperating Revenues Receipts for Transfers from System or Other Agencies Payments for Transfers to System or Other Agencies Payments for Other Uses Proceeds from Nonexchange Sponsored Programs Net Cash Provided by Noncapital Financing Activities 293,854, ,285, ,765, , ,807, (9,366,243.07) (181,246.85) ,270, ,554, ,757, , ,343, (805,914.43) Cash Flows from Capital and Related Financing Activities: Proceeds from Capital Debt Transferred from System (Nonmandatory) Proceeds from Capital Appropriations, Grants, and Gifts Proceeds from Sale of Capital Assets Payments for Additions to Capital Assets Payments of Principal on Capital Related Debt Mandatory Transfers to System for Capital Related Debt Payments of Interest on Capital Related Debt Net Cash Provided (Used) by Capital and Related Financing Activities 70,907, ,243, , (248, 174,916.27) (1,708,568.06) (96,568,343.65) (1,277, ) (234,496,035.93) 125,501, ,297, ,034, (332,867,762.18) (1,169,010.41) (92,447,798.48) (1,314,880.00) (269,966,320.90) Cash Flows from Investing Activities Proceeds from Sales of Investments Invested by System Proceeds from Interest and Investment Income Proceeds from Interest and Investment Income Invested by System Payments to Acquire Investments Invested by System Net Cash Provided (Used) by Investing Activities 180,486, ,081, (238,749,054.75) (32, 181, ) 138,754, ,043, (68,081,993.16) Net Increase (Decrease) in Cash Cash and Cash Equivalents (Beginning of the Year) Cash and Cash Equivalents (End of the Year) (80,399,640.88) 410,027, $ 329,627, ,063, ,963, $ 410,027, Reconciliation of Net Operating Revenues (Expenses) to Net Cash Provided (Used) by Operating Activities Operating Income (Loss) Adjustments to Reconcile Operating Results to Net Cash: Depreciation and Amortization Expense Bad Debt Expense Changes in Assets and Liabilities: Accounts Receivable Inventories Loans and Contracts Other Current and Noncurrent Assets Accounts Payable Due to System Unearned Revenue Employees' Compensable Leave Other Current and Noncurrent Liabilities Total Adjustments Net Cash Provided (Used) by Operating Activities (828,399,024.21) 292,207, , ,355, , , ,909, (1 '113,906.74) 1,082, (3,621 '193.47) 1 '703, (1,722,295.72) 313,708, $ (514,690, ) (758, 189,489.97) 260,336, , ,028, (577,284.60) (1 '113,964.80) (14,586,996.76) 4,713, , ,802, ,108, (1,256,418.46) 273,139, $ (485,050, ) Non Cash Transactions: Net Increase (Decrease) in Fair Value of Investments Donated Capital Assets Capital Assets Acquired Under Capital Lease Purchases Miscellaneous Noncash Transactions 107,517, ,845, ,520, (31,055,925.28) (61,806,017.28) 54,514, ,266, (17, 196,942.04)
16 7 The University of Texas at Austin Exhibit D Comparison of Budget to Actual Statement of Revenues, Expenses, and Changes in Net Position For the Year Ended August 31, 2013 Operating Budget Actual OPERATING REVENUES: Net Student Tuition Federal Sponsored Programs State Sponsored Programs Local and Private Sponsored Programs Net Sales and Services of Educational Activities Net Auxiliary Enterprises Other Operating Revenues Total Operating Revenues $ 480,532, ,148, ,895, ,473, ,050, ,117, ,059, ,245, ,029, ,674, ,609, ,081, ,430,216, ,582, 935, OPERATING EXPENSES: Instruction Research Public Service Academic Support Student Services Institutional Support Operations and Maintenance of Plant Scholarships and Fellowships Auxiliary Enterprises Depreciation and Amortization Total Operating Expenses Operating Income (Loss) 658,673, ,985, ,404, ,752, ,397, ,594, ,092, ,676, ,935, ,669, ,997, ,046, ,649, ,995, ,728, ,763, ,203, ,643, ,279,183, ,411,334, (848,966,937.00) (828,399,024.21) NONOPERATING REVENUES (EXPENSES): State Appropriations Federal Nonexchange Sponsored Programs Gift Contributions for Operations Investment Income Net Increase (Decrease) in Fair Value of Investments Interest Expense on Capital Asset Financings Other Nonoperating Revenues (Expenses) Net Nonoperating Revenues (Expenses) 295,075, ,300, ,000, ,856, ,531, ,557, ,560, ,856, ,517, (1,200,000.00) (1,277, ) (34,445,484.38) TRANSFERS AND OTHERS: Capital Appropriations, Gifts, and Sponsored Programs Additions to Permanent Endowments Transfers for Debt Service Transfers and Other Total Transfers and Other Change in Net Position 110,000, ,088, ,000, ,765, (85,893,654.00) (96,568,343.65) ,951, ,846, $===========================
17 8
18 SUPPORTING SCHEDULES 9
19 ... 0 The University of Texas at Austin Schedule A-1 Schedule of Cash, Cash Equivalents, and Investments As of August 31, 2013 Cash & Cash Equivalents Cash on Hand Petty Cash Cash in Transit Subtotal Cash on Hand Cash in Bank Demand Accounts Subtotal Cash in Bank Cash in State Treasury Available University Fund Permanent University Fund Permanent Health Fund ROI Fund 211 Local Revenue Fund Direct Deposit of Bills -Holding Account Fund Departmental Suspense Fund US Savings Bond Account Fund Deferred Compensation 401 K Fund Direct Deposit Hold- Transmit Account Fund Correction Account for Direct Deposit Fund Subtotal Cash in State Treasury Cash Equivalent Investments (Intent) US Treasury Bills and Notes Time Deposits Repurchase Agreements- Texas Treasury Safekeeping Trust Co. Money Market Funds (STF) Subtotal Cash Equivalent Investments Reimbursements due from State Treasury Total Cash and Cash Equivalents (Exhibit A) CURRENT ASSETS Unrestricted Restricted $ 203, , ,769, ,077, ,973, ,082, ,397, ,240, ,397, ,240, ,757, ,757, ,508, ,436, ,508, ,436, , '"lll II OCI "71::., nil oa 1cn n"7"> n-t $ C.."T"T 1 UV/ 1 /,JL..~I"T U"T 1 /VV 1VtV.VI NONCURRENT ASSETS Unrestricted Restricted Current Year Total Prior Year Total 209, , ,847, ,363, ,056, ,571, ,637, ,993, ,637, ,993, ,757, ,498, ,757, ,498, ,945, ,944, ,945, ,944, , , ,627, ,027,466.83
20 Schedule A-1 Schedule of Cash, Cash Equivalents, and Investments As of August 31, 2013 Investments Unrestricted NONCURRENT ASSETS Restricted Funds Held by System Administration $ 3,019,393, Pooled Operating Funds (Held by System- ITF) 782,181, ,999, Bonds and Preferred Stock Stocks Real Estate Mortgages and Other Notes Real Estate Mineral Rights and Other Royalties Physical Commodity Investment Funds Other Investments 85, , Investment Derivatives -Asset Positions Total Investments (Exhibit A) 782,266, ,310,408, Securities Lending Collateral Current Year Total Prior Year Total 3,019,393, ,868,359, ,073,181, ,971, , , ,092,675, ,746,408, Total Investments and Securities Lending Collateral (Exhibit A) $ 782,266, ,310,408, ,092,675, ,746,408,863.65
21 ... N Schedule A-3a The University of Texas at Austin Schedule of Legislative Appropriations For the Year Ended August 31, 2013 General Revenue Appropriations Legislative BAlANCES Deduct Estimated Reported Appropriation August 31, 2011 Currently Locally Collected as BAlANCES Number Approeriations Aeproenated Income as Applied Income Transfers Exeended Laesed August 31, 2013 Current General Funds 5.8.1, 81st Legislature, Regular Session Advanced Research Program , (479,412.64) 62, Fire Ant Program , , H.B.1, 82nd Legislature, Regular Session Educational and General State Support ,265, ,265, Advanced Research Program ,069, (669, ) 135, , Mentoring Achievement Latino Education , , , Intensive Summer Program HB 2237 Grants , , Fire Ant Program , , , Group Insurance , , , Social Security Matching , , , , Optional Retirement Program Matching (441,200.24) (441,200.24) (441,200.24) Matching Portion of Staff Benefits Paid by State Retirement Plans n/a (24,077.04) (24,077.04) (24,077.04) Educational and General State Support ,373, ,225, ,147, (15,874,339.00) 228,827, , Advanced Research Program ,372, , , College Workstudy Program , , Mentoring Achievement Latino Education , , Fire Ant Program , , , HB 1025 Sect 07 UT Austin Reduction (2,000,000.00) (2,000,000.00) 2,000, Group Insurance ,627, ,627, ,627, Social Security Matching ,822, ,822, ,820, , Optional Retirement Program Matching ,518, ,518, ,518, Matching Portion of Staff Benefits Paid by State Retirement Plans n/a 3,272, ,272, ,272, Unemployment Compensation Insurance n/a 67, , , Total General Revenue Appropriations 2,975, ,526, ,225, ,300, (13,332,395.51) 280,521, ,421,586.11
22 13 The University of Texas at Austin Schedule B-1 E&G Funds- Summary of Operations For the Year Ended August 31, 2013 Operating Revenues: Gross Student Tuition Other Fees Discounts & Allowances Tuition and Fees Net Tuition and Fees Federal Sponsored Programs Pass-Through from State Agencies State Sponsored Programs Pass-Through from State Agencies Sales and Services of Educational Activities Other Operating Revenues $ Total 118,467, , (24,474,741.07) 94,220, (1,500.00) 37,577, , Student Activities 118,467, , (24,474,741.07) 94,220, (1,500.00) 37,577, , Total Operating Revenues 132,014, ,014, Operating Expenses: Salaries and Wages Payroll Related Costs Professional Fees and Services Other Contracted Services Travel Materials and Supplies Utilities Communications Repairs and Maintenance Rentals and Leases Printing and Reproduction Scholarships and Fellowships Other Operating Expenses Total Operating Expenses Operating Income (Loss) 442,933, ,314, ,079, ,032, ,871, ,389, , ,724, ,970, ,098, , ,372, (494,891 '176.18) 442,933, ,314, ,079, ,032, ,871, ,389, , ,724, ,970, ,098, , ,372, (494,891 '176.18) Nonoperating Revenues (Expenses): State Appropriations Investment Income Net Increase (Decrease) in Fair Value of Investments Net Nonoperating Revenues (Expenses) Income (Loss) Before Other Revenues, Expenses, Gains or Losses: Transfers In Transfers Out Change in E&G Funds Net Position 292,300, ,373, ,254, (199,636,404.96) 285,830, (70,728,633.23) 15,465, Net Position- September 1, ,250, Net Position- August 31, 2013 (See NOTE) $ 241,715, NOTE: Ending Net Position August 31, 2013 was composed of the following: Unrestricted: Reserved Eocum~oc~ $ Accounts Receivable (less unearned revenue portion) Other Specific Purposes: Advanced Research Program I Advanced Technology Program I TOT Prepaid Expenses lmprest Funds (from Schedule A-1) Unreserved Allocated 3,966, ,151, , ,483, , Startup I Matching 11,619, Research Enhancement and Support 16,469, Instructional Program Support Total Unrestricted Net Position $ 241,715, =========
23 Schedule B-2 Designated Funds - Summary of Operations For the Year Ended August 31, j>. Operating Revenues: Gross Designated Tuition Other Fees Discounts & Allowances Designated Tuition and Fees Net Designated Tuition and Fees Federal Sponsored Programs Federal Sponsored Programs Pass-Through from State Agencies State Sponsored Programs Pass-Through from State Agencies Local Sponsored Programs Private Sponsored Programs Sales and Services of Educational Activities Discounts and Allowances Sales and Services of Educational Activities Other Operating Revenues Total Operating Revenues Operating Expenses: Salaries and Wages Payroll Related Costs Cost of Goods Sold Professional Fees and Services Other Contracted Services Travel Materials and Supplies Utilities Communications Repairs and Maintenance Rentals and Leases Printing and Reproduction Scholarships and Fellowships Other Operating Expenses Total Operating Expenses Operating Income (Loss) Nonoperating Revenues (Expenses): Federal Nonexchange Sponsored Programs Investment Income Net Increase (Decrease) in Fair Value of Investments Gain (Loss) on Sale of Capital Assets Other Nonoperating Revenues Other Nonoperating (Expenses) Net Nonoperating Revenues (Expenses) Income (Loss) Before Other Revenues, Expenses, Gains or Losses: Transactions Between Funds Transfers In Transfers Out Change in Designated Funds Net Position Net Position - September 1, 2012 Net Position- August 31, 2013 (See NOTE) $ Total Instruction and Other Net Service Departments 354,531, ,531, ,005, ,005, (106, ) ( ) 364, , ,476, ,476, ,487, ,487, ,383, ,383, , , ,669, ,669, ,715, ,786, ,929, (61,800.19) (61,800.19) 7.430, ,130, , ,237, , ,702, ,210, ,492, ,455, ,467, ,988, ,137, ,260, , ,471, ,309, , ,008, ,792, ,215, ,671, ,554, , ,060, ,512, ,547, ,858, ,120, ,738, ,462, ,251, ,211, ,040, ,103, ,936, ,146, ,868, , ,378, ,295, , ,213, ,211, , ,343, ,916, , , ,873, , , , ,566, ,212, (169,960.89) 163, (99,579.57) , ,248, , ,703, ( ,541.55) 86,716, ,546, $ 415,262,566.90
24 Schedule B-2 Designated Funds - Summary of Operations For the Year Ended August 31, 2013 NOTE: Ending Net Position August 31,2013 was composed of the following: Unrestricted: Re: Encumbrances Accounts Receivable (less unearned revenue portion) Inventories Other Soecific Purooses: Prepaid Expenses lmprest Funds (from Schedule A-1) Unreserved $ 20,890, ,092, ,104, ,562, , Alloc Capital Projects Startup I Matching Utilities Reserve Research Enhancement and Support Market Adjustments Student Fees Texas Tomorrow Fund Shortfall Instructional Program Support Self Supporting Enterprises Total Net Position , , ,713, ,913, ,652, ,987, ,606, ,365, ,453, $ 415,262, ~ 01
25 THE UNIVERSITY OF TEXAS AT AUSTIN Schedule B-2A: Schedule of Changes in Fund Balances Unrestricted Current Funds- Designated Funds- Service Departments For the Year Ended August 31, 2013 ~ rn Additions Deductions Service Department Funds: Balance 9/1/12 Credits from Services Interest & Investment Income Expenditures Transfers & Adjustments Balance 8/31/13 ACES-IT- VIDEOCONFERENCING 41, , ACES-IT GROUP 12, , ADMN-REPORTING ADJUSTMENTS (2,855,984.88) (35,806.47) ADMN-RES FOR LUMP SUM PAY OF VAG/SICK LV (455,766.80) AER- AEROSPACE ENGINEERING MACHINE SHOP 47, , ARC -ANIMAL RESOURCES CENTER 11, ,964, ARL -ABSENT TIME POOL 1,036, ,046, ARL -COMPUTER EQUIPMENT USAGE 255, , ARL-GENERALSTOCK 24, , ARL -LAKE TRAVIS TEST STATION & DIVER OP 51, , ARL -MACHINE SHOP 195, , ARL -PDC PRORATED DIRECT COSTS 1,442, ,988, ARL -VEHICLES 9, , BEG -ADMINISTRATIVE STAFF OPERATIONS 774, '122, BEG -COPIER 11, BEG -ENVIRONMENTAL LABORATORY 167, , BEG -ILRIS 3-D IMAGING 25, , BEG -IT 584, , BEG-LIDAR 1,277, , BEG -NANO GEOSCIENCES LAB 59, , BEG -SEM LAB 61, , BEG-SUPPLY 5, BEG -TELEPHONE EQUIPMENT 25, BEG -VEHICLE 58, , BFS-CENTRALSTORESINVENTORY 1,086, ,142, BFS-PRC-CENTRALSTORESINVENTORY 249, , BIO- DROSPHILA FOOD 18, , CE -VEHICLES 1, CEC -CEC SERVICE CENTER 28, , CEER-CEER COMPUTER MODELING 27, , CEER-CES- COPIER CEER-DTA ANALYTICAL LAB SERVICES 50, , CEER-VEHICLE ACCOUNT 15, , CEM -ABSENT TIME POOL (369,855.23) CEM -ALGAE TESTING & ANALYSIS 50, CEM -AUTOCLAVE RECOVERY (19,675.63) CEM -COMPUTER REPLACEMENT 30, CEM -COMPUTER SOFTWARE LICENSE (26,239.58) 168, (43,960.87) (2, ) (13,773.74) (1,695,715.66) 81,784,94 (17, ) 473, (153,900.91) (34, ) (1,840,836.94) 2, (6, 126,837.04) (150,975.86) (101,474.61) (172,233.42) (332, ) (86, ) (154,900.00) (13,733,113.65) (181,144.36) (67,471.02) (1,223,725.41) 42, (12,517.66) (1 0,985.11) (4,593.80) (524,769.97) (472,300.79) (275,562.64) (364,459.00) (26,054.55) (57,067.97) (5,457.39) (416.05) (24,608.71) (52,665.97) (1,785,561.63) (85,251.06) (243, ) (42,768.69) (1,481.44) (21,234.07) (4,338.62) (986.00) (48,873.34) (4,865.51) (88,902.58) (28,542.48) (219.97) (140,838.44) (4,505, ) 21, , , , , , , ,516, , , , , , , , , , ,357' , , ,943,99 30, , ,221 "16 (458,757.81) 21, (19,675.63) 29, ,519.05
26 Schedule B-2a (Continued) Additions Deductions Service Department Funds: Balance 9/1/12 Credits from Interest & Transfers & Expenditures Services Investment Income Adjustments Balance 8/31/13 CEM -GRAPHICS & COPIER SERVICES 15, , (13,765.57) - 18, CEM -LAB SERVICES MACHINE SHOP 14, , (22,903.80) (15,664.53) CEM -LABORATORY FABRICATION FACILITY 133, , (319,059.61) (30,394.24) 2, CEM -RESIDUAL LABORATORY FACILITY 90, , (207, ) - (8, ) CEM -VEHICLES 3, , (2,012.83) - 3, CERC-COMP ENG RESEARCH CTR-COMP COSTS , (64,836.97) - 11, CERC-COMP ENG RESEARCH CTR-PUBLICATIONS 7, (3,326.95) 4, CHEM-CHEM & BlOCH EM NITROGEN 48, , (142,257.75) - 48, CHEM-CHEM-BIOCHEM ANALYTICAL SRVES 147, , (279,349.44) (27,141.21) 185, CHEM-CHEMISTRY FLUORIMETERS/SPECTRO CHEM-CHEMISTRY STOREROOM 57, ,629, (1,644,849.56) - 42, CHEM-ELEMENTAL ANALYSIS 3, (1 '127.83) - 2, CHR -RMC COPY CHARGES 2, (2,319.43) CMRG-C.M.R.G.- VEHICLE , (1,589.52) CNMS-CNM INSTRUMENTATION (153,028.76) 170, (1,341.76) (5,928.00) 10, CRWR-EWRE SERVICE CENTER 14, , (57,735.40) 18, CRWR-MST KIRISTS SERVICE CENTER 2, , (37,689.16) - 7, CS -COMPUTER SCIENCES SERVICE CTR 49, , (116,318.10) 58, CSSB-UT MICROARRAY CORE FACILITY 20, , (2,247.21) 31, CTL -CTL- EVALUATIONS & MEDIA SERVICES 37, , (34,261.88) - 7, CTR -COPY CHARGES 13, , (9,665.33) - 13, CTR-INFRASTRUCTURE MATERIALS PERFORMANC 17, , (26,519.25) (12,849.00) 10, CTR- VEHICLES 21, , (4,847.38) - 29, DANA-DANA CENTER COPIER SERVICE (4,649.52) 15, (15,855.18) (5,449.66) DDI -THERAPUTEX PRE-CLINICAL CORE LAB (12,512.80) 75, (45,977.38) - 17, DDI-TI3D AUTOMATION FACILITY SRV CTR 52, , (20,974.53) 99, DNS -GRAPHIC ARTS 8, , (21,772.39) - 4, DNS-GREENHOUSEFEE , (52,737.50) 5, DOCS-UNIVERSITY COPY SERVICES 774, ,172, (2,521,314.72) 123, , DOCS-UNIVERSITY MAIL SERVICES 212, ,987, (2,072,503.62) - 126, DOCS-UNIVERSITY PRINTING SERVICES 662, ,884, (4,201,301.90) (93,644.00) 251, DOCS-UNIVERSITY SUPPLY SERVICES 517, (83, ) - 434, DPRI-FLOW CYTOMETRY CORE 6, , (33,821.09) - (5,802.59) DPRI-HISTOLOGY & IMAGING 4, , (16,856.81) (4,202.24) EHS- BSC CERTIFICATION 6, , (26,238.53) - 6, EHS -EHS EVENTS/PROJECTS 1, (1,537.23) - -.J FIRE-FPS-OVERTIME 24, , (75,548.45) - 26, FSEL-FSEL: EQUIPMENT USE FEES 4, (12,502.30) 9, ,016.77
27 Schedule B-2a (Continued) Additions Deductions Service Department Funds: Balance 9/1/12 Credits from Interest & Transfers & Expenditures Services Investment Income Adjustments Balance 8/31/13 FSEL-SPECIMEN REMOVAL 2, , (12,892.78) - 5, FSEL-VEHICLE CHARGES , (2,420.30) GEC -GEOTECHNICAL EQUIPMENT FUND 42, (10,960.82) - 31, GEC -NEES EQUIPMENT ACCOUNT 9, , (16,857.01) 41, GEOL-E-BEAM LABS 48, , (41,251.78) - 68, GEOL-H-R X-RAY CT FACILITY 305, , (223,707.46) (13,685.64) 353, GEOL-ICP-MS AND ISOPROBE 22, , (68,815.94) - 22, GEOL-ISOTOPE CLEAN LABORATORY/BANNER 8, , (20,430.18) - 9, GEOL-RADIOGENIC ISOTOPE CLEAN LAB - 36, (26,307.17) - 9, GEOL-STABLE ISOTOPE I BARNES & BREEKER 11, , (48,824.32) - 22, GEOL-STABLE ISOTOPE I SHANAHAN 96, , (47,025.51) (11,317.50) 218, GEOL-STABLE ISOTOPE/QUINN 1, , (84,076.85) - 14, GEOL-THERMOCHRONOLOGY- STOCKLI - 243, (193,777.91) (56,046.00) (6,491.58) GEOL-TIMS/LASSITER 7, , (1 0,631.91) - 18, GEOL-UNDERGRAD STUDENT COMPUTER LAB OP (3.95) GEOL-VEHICLE REPAIR & SERVICE 14, , (53,256.80) - 31, HRC- THEATER USE FEE 24, , (6,428.04) 26, HRS -HRS BACKGROUND CHECKS 50, , (216,370.21) - 37, IAT -FABRICATION CENTER (4,484.64) 4, IAT -IAT REPAYMENT (693.60) ICES-COMPUTING LAB ICES-PHOTOCOPY MACHINE EXPENSES 5, , (4,763.96) - 1, ICMB-DNA & GENOiy'IIC FACILITY 665, , (337,207.76) (370,255.19) 421, ICMB-ELECTRONICS AND GENERAL REPAIR SHOP 6, , (29,492.94) 8, ICMB-GEN SEQ & ANAL Y FACILITY SVC CTR 59, , (781,012.27) - 180, ICMB-ICMB STOREROOM 1, , (709,796.23) 11, ICMB-MICROSCOPY & IMAGING FACILITY 200, , (313,233.33) - 163, ICMB-MOUSE GENETIC ENGINERRING FACILITY 167, , (58, ) 131, ICMB-STOREROOM 17, , (530,327.22) - 15, INTB-DUPLICATING SERV (93.40) (0.15) IRC -IMAGING RESEARCH CENTER-USAGE FEES 688, , (770,311.53) 575, , ITS -COMPUTATION CENTER RECEIVABLES (225,000.00) (225,000.00) ITS -DATA CENTER SERVICES 14, , (1,334,798.75) 1,320, , ITS -ITS - UTBACKUP , (3,304.36) 10, , ITS -ITS APPLICATIONS CONTRACTS 250, (511,954.57) - (261,753.82) ITS -ITS AUSTIN DISK 147, (9,943.22) - 137, ITS -ITS COMMODITY STORAGE - 60, (96,418.31) 25, (10,247.70) ITS -ITS LAB SUPPORT 156, (161,459.24) - (4,882.54)
28 Schedule B-2a (Continued) Additions Deductions Service Department Funds: Balance 9/1/12 Credits from Interest & Transfers & Expenditures Services Investment Income Adjustments Balance 8/31/13 ITS -ITS MANAGED SERVICES 351, (208,977.92) 142, ITS -ITS N&T VOICE SERVICES 32, , ITS -ITS SOFTWARE CLEARING (2,037.40) , , ITS -ITS VMU SERVICE CENTER 175, (114,953.29) - 61, ITS -MANAGED DESKTOP SUPPORT SERVICES - 634, (992,501.12) 258, (99,678.77) ITS -N&T BUILDING SECURITY 19, , ITS -OPERATIONS 4,659, ,248, (30,921,601.94) (3,023,765.80) 2,962, ITS -PREPAID CLEARING ACCT (48,697.62) (48,697.62) ITS -PRINTING SERVICES 293, , (203,818.87) 48, , ITS -PUBLIC NETWORK ACCESS 152, , (1,578.40) (150,000.00) 141, ITS-RESNET 1,742, ,534, (840,451.82) 5, ,441, ITS -SOFTWARE DEVELOPER TRAINING PROGRAM 130, , (394,976.72) 153, , LAW -CLEARING ACCOUNT 2, (625.57) - 2, LBJ -VIDEO CONFERENCING (92.72) LLB -LIB ARTS BULK PURCHASING PROGRAM (26.67) , , LLB -LLB- LIBERAL ARTS MEDIA SERVICES 3, , , LLB -REVOLVING-LAITS MBS -PATTERSON MICROSCOPY CENTER 3, , (8, ) 3, MBS -SHARED EQUIPMENT FUND 19, , (1 0,399.34) - 18, MCD -MCDONALD OBSERVATORY PHOTOCOPYING , (10,446.72) ME -DESIGN PROJECTS PROGRAM 46, , (34,190.71) 33, ME- MECHANICAL ENGINEERING MACHINE SHOP 100, , (97,738.00) - 102, MR -MRC USAGE FEES 365, , (764,992.19) (72,005.00) 236, MSIP-ANAL YTICAL SERVICES 102, , (87,555.01) - 97, MSIP-CLEARING ACCOUNT (2,969.55) - - 2, (244.07) MSIP-COPY CHARGES 7, , (19,281.66) 7, MSIP-MARINE GENETIC ANALYSIS 14, (2,946.59) - 11, MSIP-ORGANIC GEOCHEMISTRY ANALYSIS 11, , (6,306.29) 20, MSIP-VEHICLES 19, , (54, ) 30, NETL-NUCLEAR REACTOR LAB 151, , (125,811.06) - 116, NEUR-NEUROBIOLOGY DUPLICATING SERVICES (0.96) OA-TXSHOP 23, , (57,719.93) - 20, OTS -U.T. SYS OFC OF TELECOMM SERVICES 3,185, ,017, (3,366,809.05) (543,402.54) 3,292, PHR -FORTY ACRES PHARMACY PASS-THROUGH , (96,054.79) PHR -LEARNING RESOURCES CENTER 4, , (6,538.41) - 6, PHR -PROTEIN & METABOLITE ANALYSIS FAG 90, , (65,516.63) (6,995.00) 112, <D PHY -CENTRALIZED GAS (9,970.00) 219, (185,915.06) - 23, PHY -MACHINE SHOP , (2,501.80) 3, ,177.69
29 Schedule B-2a (Continued) "' 0 Additions Deductions Service Department Funds: Balance 9/1/12 Credits from Interest & Transfers & Expenditures Services Investment Income Adjustments Balance 8/31/13 PHY -PHYSICS SHOP 3, (3,801.09) PMCS-MAJOR RENOVATION PROJECT SVC CTR 10, (3,025.84) - 7, PUR -UT SYSTEM CAMPUSES SUPPORT- PURCH SW -SCHOOL OF SOCIAL WORK COPIERS 9, (8,466.07) (0.01) 1, TARL-TARL SERVICE CENTER 228, (1 04,431.43) - 124, TEMP-TEMPORARY SERVICES PROJECT 377, ,747, (4,540,947.45) - 583, TMI -TMI- CORE CENTRAL FACILITIES 220, , (282,013.17) - 204, TMI-TMI X-RAY LAB 25, , (5,871.60) (6,349.53) 25, TREC-TECH RESOURCES SUPPORT 130, , (1,027,586.53) 479, , UC-UMCS 27, , (560,139.31) - 58, UTIG-COMPUTER NETWORK 20, , (47,124.52) - 135, UTIG-GEOPHYSICAL SYSTEMS SERVICE CENTER 78, , (8,149.98) (13,563.55) 124, UTIG-GEOPHYSICS VEHICLE 4, , (7,640.31) - 6, UTIL-IMPRVMT, R&R, ELEVATOR MAINTENANCE 108, ,927, (2,009,708.97) - 26, UTIL-PASS-THROUGH UTILITIES (18,566.76) 8,089, (8,200,872.84) - (129,894.59) UTIL-UTILITY PLANT 4,117, ,146, (38,350,629.35) (11,191,308.90) 5,721, UTPD-SECURITY AT U.T. SYSTEM 119, , (507, ) (32,193.62) 98, UTPD-SECURITY SERVICES- DEPARTMENTS 121, , (367,883.87) (96,532.18) 109, UTPD-UTPD SECURITY SERVICES 70, ,357, (1,270,932.82) - 157, VPBA-DRIVER TRAINING 1, , (17,340.00) (1,703.98) 1, VPBA-INSURANCE PREMIUMS 136, , (228,747.95) - 191, Total Service Department Funds 25,960, ,536, (143,753,392.02) (13,933,629.16) 25,809, ADMN-INTERDPEARTMENT CREDITS - (114,305,819.55) - 110,677, ,628, (0.00) Net Service Department Funds 25,960, ,230, (33,075,814.33) (1 0,305,387.30) 25,809,781.32
30 Schedule B-2a (Continued) Additions Deductions Service Department Funds: Balance 9/1/12 Credits from Services Interest & Investment Income Expenditures Transfers & Adjustments Balance 8/31113 B-2A Footnote: Capitalized Expenditures 1912 (ELIM SC EXPENSE-COGS) Gain/Loss on Disposal of Equipment Balance Sheet Transactions Between Funds Transfer From/To Designated Funds (Schedule B-13) Transfer From/To Auxiliaries (Schedule B-13) Transfer From/To Unexpended Plant Funds (Schedule B-13) Transfer From/To U.T. System Administration- Retirement of Indebtedness (Sch B-13) Totals ($1,083,735.41) $0.00 ($169,960.89) $251, $2,723, $402, ($1,638,615.79) ($1 0, 790,525.56) ($10,305,387.30) "-' -'"
31 Schedule B-3 Auxiliary Enterprise Funds -Summary of Operations For the Year Ended August31, 2013 ~ ~ Operating Revenues: Student Fees Discounts & Allowances Student Fees Net Student Fees Sales and Services Rentals and Leases Parking Violations Other Operating Revenues Discounts and Allowances Auxiliary Enterprises Net Auxiliary Enterprises Total Operating Revenues Total Intercollegiate Athletics Housing and Food Student Health Service Parking and Traffic Center Student Service Fees Student Activities 44,674, ,674, (8,228,037.60) (8,228,037.60) 36,446, ,446, ,565, ,202, ,019, ,171 ' ,807, ,524, ,840, , ,582, , ,112, , , , 166, '167, (1,816.67) 10, , , , (205.95) (112.35) (13,385,737.79) (3,897.33) (22,923,(JQL lbl14.3_0)_ (13,356,803.16) 254,081, ,784, ,063, ,434, ,809, ,737, ,252, ,528, ,784, ,063, ,434, Other 4,809, ,184, ,252, Operating Expenses: Salaries and Wages Payroll Related Costs Cost of Goods Sold Professional Fees and Services Other Contracted Services Travel Materials and Supplies Utilities Communications Repairs and Maintenance Rentals and Leases Printing and Reproduction Scholarships and Fellowships Other Operating Expenses Total Operating Expenses 98,798, ,978, ,877, ,497, ,271, ,222, ,608, , ,987, ,668, ,320, ,451, , ,736, ,765, ,245, ,119, , , ,013, ,732, ,530, ,638, , ,290, ,149, , ,493, ,490, ,647, ,242, ,973, ,281, ,449, , , ,257, ,205, , , ,525, , ,125, , , , ,421, , , , , , , , ,372, ,900, ,178, , ,977, ,348, , ,158, ,984, ,247, ,824, ,339, , , , , , , ,375, ,340, , ,014, , , , ,670, , ,459, ,616, , , , , , ,033, ,046, , , ,068, , , , , , (202,898.04) 75, , ,832, ,051, ,083, , ,405, ,318, Operating Income (Loss) 48,763, ,293, ,690, ,533, (6,274,230.98) (193,453.17) 16,778, (6,065,586.78) Nonoperating Revenues (Expenses): Investment Income Net Increase (Decrease) in Fair Value of lnvesbnents Other Nonoperating (Expenses) Net Nonoperating Revenues (Expenses) 3,435, ,723, (13,629.08) 6,145, Income (Loss) Before Other Revenues, Expenses, Gains or Losses Transactions Between Funds Transfers In Transfers Out 54,908, (249,999.88) 78,315, (118,816,704.50) Change in Auxiliary Funds Net Position 14,156, Net Position- September 1, 2012 Net Position- August 31, 2013 (See NOTE) 36,988, ' 145, NOTE: Ending Net Position August 31, 2013 was composed of the following: Unrestricted: Reserved Encumbrances Accounts Receivable (less unearned revenue portion) Inventories Other Specific Purposes: Prepaid Expenses lmprest Funds (from Schedule A-1} Unreserved Allocated Capital Projects Student Fees Total Unrestricted Net Position 7,577, ,191, , ,240, , ,292, ,402, ,145,526.63
32 Schedule B-4 Restricted Expendable Funds- Summary of Operations For the Year Ended August 31, 2013 Operating Revenues: Sponsored Program Revenues Sponsored Program Pass-Through From State Agencies Net Sales and Services of Educational Activities Total Operating Revenues $ Total Federal Federal indirect Cost Recoveries State State Indirect Cost Recoveries 411,891, ,385, (79, 187,230.03) 38,468, ,686, (2,374,911.98) 14,928, (772,217.56) 17,939, ,908, (502,791.63) 15,897, (1,363,931.83) Local indirect Private Indirect Local Cost Recoveries Private Sector Cost Recoveries 7, 765, (884,538.83) 107,442, (11,631,091.56) 468,298, ,981, (g064,933_m) 3(),82~, (2, 136,149,39) 7,765, (884,538.83) 107,442, (11,631,091.56) Operating Expenses: Salaries and Wages Pairoll Related Costs Cost of Goods Sold Professional Fees and Services Other Contracted Services Travel Materials and Supplies Utilities Communications Repairs and Maintenance Rentals and Leases Printing and Reproduction Claims and Losses Scholarships and Fellowships Federal Sponsored Passthroughs to State Agencies State Sponsored Passthroughs to State Agencies Other Operating Expenses Total Operating Expenses Operating Income (Loss) 283,481, ,583, , ,348, ,289, ,392, ,070, , ,814, ,135, ,738, ,037, ,489, ,594, , ,013, ,350, ,139, ,925, , , ,240, ,002, , ,527, ,483, , ,930, , ,951, , , , , , ,290, , , , , , , , , , ,175, ,566, , ,651, ,654, ,434, ,955, , ,979, ,192, ,404, ,241, ,961, ,932, , , ,858, ,692, ,692, , , ,687, ,622, , , ,301, ,475, ,424, ,211, ,805, ,033, (167, 176,985.94) 1()1,557,051, :3 j S_06<),_933.64)- _2,614,348~5_8 (2,136, ) 959,354_,!)_6_ (88<\,!)38.83) (175,591,027.49) (11,631,091.56) Nonoperating Revenues (Expenses): Federal Nonexchange Sponsored Programs Gift Contributions for Operations Investment Income Net Increase (Decrease) in Fair Value of Investments Interest Expense (Notes) Other Nonoperating (Expenses) Net Nonoperating Revenues (Expenses) Income (Loss) Before Other Revenues, Expenses, Gains or Losses Transactions Between Funds Gifts and Sponsored Programs for Capital Acquisitions Transfers In Transfers Out $ 68,799, ,557, ,682, ,31 0, (1,277,137.00) (68,038.20) 338,004, ,827, ( 1,258,568.18) 42,243, ,647, (182, 743,637.28) NOTE: Indirect Cost Recoveries made up as follows: Instruction Research Public Service Academic Support Scholarships and Fellowships Total indirect Cost Recoveries 722, ,076, ,651, , , ,716, Change in Restricted Expendable Net Position 41,716, Net Position- September 1, ,324, Net Position- August 31, 2013 $ 422,040, '0 w
33 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ Net Position September 1, 2012 Gift Additions to Endowments Investment Income Net Increase (Decrease) in Fair Value of Investments Investment Income (Realized Gains and Losses) Net Other Additions/ Deductions Net Position August 31,2013 TRUE ENDOWMENT FUNDS INSTRUCTION Abbott Centennial Fellowship In Pharmacy George T. And Gladys H. Abell Endowed Chair Of Adnan Abou-Ayyash Centennial Professorship In Christie And Stanley E. Adams, Jr. Centennial Elsie And Stanley E. Skinny Adams, Sr. Centennial A. M. Aikin Regents Chair In Junior And Community Alcon Centennial Professorship In Pharmacy The Alec Center For Creativity Endowment Fund Hussein M. Alharthy Centennial Professorship In Civil Hussein M. Alharthy Centennial Chair In Civil Edwin Allday Centennial Chair In Subsurface Geology Allied Bancshares Centennial Fellowship In Finance Nasser I. AI-Rashid Centennial Professorship In Nasser I. AI-Rashid Chair In Civil Engineering Nasser I. AI-Rashid Friend Of Alec Excellence Fund Alumni Centennial Endowed Fellowship In Pharmacy Accenture Endow Professorship- Manufacturing Systems Arthur Andersen And Co. Alumni Centennial Professorship Arthur Andersen And Co. Alumni Centennial Professorship Andrews And Kurth Centennial Professorship In Law Jean Andrews Centennial Faculty Fellowship In Jean Andrews Centennial Faculty Fellowship In Human William H. Arlitt Lectureship In Economics William H. Arlitt, Jr. Professorship In The College Robert M. Armstrong Centennial Professorship Howrey Lip And Arnold, White And Durkee Centennial Mr. And Mrs. Isaac Arnold, Sr. Regents Chair In Atlantic Richfield Centennial Faculty Fellowship In E. Bagby Atwood Memorial Library Fund Austin Industries Endowed Faculty Fellowship In Civil Nationsbank OfTexas, N. A. Centennial Fellowship No Nationsbank OfTexas, N. A. Centennial Fellowship No The Bfgoodrich Endowed Professorship In Materials Romeo T. Bachand, Jr. Regents Professorship In Baker And Botts Regents Research Professorship In Law Hines H. Baker And Thelma Kelley Baker Chair In Law 168, ,055, , , , ,826, , , ,764, ,219, ,151, , , , , , , ,126, , , , , , , , , ,505, , , , , , , , , ,717, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,180, , , , ,890, , , ,826, ,261, ,238, , , ,500, , , , ,166, , , , , , , , , ,664, , , , , , , , ,778,120.57
34 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments R. C. Baker Foundation Seminar Room 33, Rex G. Baker Centennial Chair In Natural Resources 2, 178, Rex G. Baker And Edna Heflin Baker Professorship In 471, Rex G. Baker, Jr., Professorship Of Political Economy 424, Rex G. Baker, Jr. And Mcdonald Observatory Centennial 371, Anne Mortimer Ballantyne Lectureship 70, Stephen P. Ballantyne Endowed Excellence Fund 72, , Banctexas Group, Inc. Lectureship In Finance 95, Eugene C. Barker Centennial Professorship In American 613, E.M. Barron Fund 484, Leonidas T. Barrow Centennial Chair In Mineral 3,229, Sam Bars hop Centennial Fellowship 619, Sam Barshop Centennial Lectureship In Business 71, Sam Bars hop Centennial Professorship Of Marketing 338, Sam Barshop Regents Professorship In Business 260, James L. Bayless Chair For Free Enterprise 2,465, James L. Bayless/Enstar Chair In Business 1,532, James L. Bayless/W. S. Farish Fund Chair For Free 1,473, James L. Bayless/Rauscher Pierce Refsnes, Inc. Chair 1,708, John A. Beck Centennial Professorship In 586, Henry Beckman Professorship In Chemical Engineering 300, Myron L. Begeman Fellowship In Engineering 166, Behrens Inc. Centennial Professorship In Pharmacy The Spurgeon Bell Centennial Fellowship 150, WarrenS. Bellows Centennial Professorship In Civil 348, Lloyd M. Bentsen Chair In Law 337, Lloyd M. Bentsen, Jr. Chair In Government/Business 3,771, Edwin E. Beran Centennial Lectureship In Architecture 165, W. P. Pat Biggs Classroom Endowment Fund 28, R. H. Bing Fellowship In Mathematics No.1 328, R. H. Bing Fellowship In Mathematics No.3 359, R. H. Bing Fellowship In Mathematics No.4 307, R. H. Bing Fellowship In Mathematics No.5 298, R. H. Bing Fellowship In Mathematics No.6 305, Joseph H. Blades Centennial Memorial Professorship 508, Joseph H. Blades Memorial Centennial Professorship 1,048, Sidney F. And Doris Blake Centennial Lectureship 112, Sidney F. And Doris Blake Centennial Professorship 1,150, William B. Blakemore li Regents Professorship 363, William B. Blakemore li Regents Professorship 434, JackS. Blanton, Sr. Chair In AJJstralian Studies 1,585, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August31, ' , , ,255, , , , , , , , , , , , , , , , , , , , ,358, , , , , , , , , ,552, , ,586, , ,525, , ,768, , , , , , , , , , , , , , , ,903, , , , , , , , , , , , , , , , , ,085, , , , '190, , , , , N (]! 55, ,641,079.97
35 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than Stale As of August 31, 2013 N (J) Net Position Gift Additions to September 1, 2012 Endowments JackS. Blanton, Sr. Chair In History 2,616, Jack And Laura Lee Blanton Lectureship In Nursing 93, Laura Lee Blanton Chair In Nursing 1,202, Bloomer Fund For Motivated And Late Bloomer Students 423, Jane And Roland Blumberg Centennial Professorship 404, Jane And Roland Blumberg Lectureship In Mathematics 199, Jane And Roland Blumberg Visiting Professorship 159, Jane And Roland Blumberg Centennial Professorship 375, Jane And Roland Blumberg Centennial Professorship 417, Jane And Roland Blumberg Centennial Professorship 341, Jane And Roland Blumberg Professorship In Physics 352, Jane And Roland Blumberg Centennial Professorship 492, Jane And Roland Blumberg Centennial Professorship 468, William David Blunk Memorial Professorship 404, Mody C. Boatright Regents Professorship In American 267, Harold C. And Mary D. Bold Regents Professorship Of 282, Mary D. Bold Regents Professorship Of Music 240, Eugene And Dora Bonham Memorial Fund In History 683, Z. D. Bonner Professorship Of Chemical Engineering 532, Robert Emmett Booker Undergraduate Fundamentals 73, Annis And Jack Bowen Endowed Professorship In 812, Leslie Bowling Professorship In Geological Sciences 561, Don R. And Patricia Kidd Boyd Lectureship In 171, The Malcolm And Minda Brach man Fellowship In 305, Earl N. And Margaret Brasfield Endowed Faculty 453, Janey Slaughter Briscoe Centennial Fellowship 614, Albert P. Brogan Memorial Fund 29, Billye J. Brown Excellence Fund 186, Jay H. Brown Centennial Faculty Fellowship In Law 156, Morton Brown, Nellie Lea Brown, And Minelma Brown 4,005, Brunswick-Abernathy Regents Professorship In Soil 579, Bergen Brunswig Corporation Centennial Fellowship 143, David Bruton, Jr. Centennial Chair In Business 1,557, David Bruton, Jr. Centennial Professorship In Art 331, David Bruton, Jr. Centennial Professorship 426, David Bruton, Jr. Centennial Professorship 369, David Bruton, Jr. Centennial Professorship 580, David Bruton, Jr. Centennial Professorship 340, David Bruton, Jr. Centennial Professorship 480, David Bruton, Jr. Centennial Professorship In Urban 331, David Bruton, Jr. Regents Professorship In Fine Arts 575, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 91, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , , , , Net Position August 31, ,708, , ,244, , , , , , , , , , , , , , , , , , , , , , , , , , , ,145, , , ,612, , , , , , , , ,305.64
36 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position September 1, Fred M. Bullard Professorship In 659, James 0. Burke Centennial Fellowship In Pharmacy Henry M. Burlage Centennial Endowed Professorship In 440, Albert Sidney Burleson Professorship 33, John S. Burns Faculty Fellowship 338, Johns. Burns Lectureship 55, Fellowship In Business 147, _ College of Business Administration 358, CBA Foundation Advisory Council Centennial Fellowship 297, CBA Foundation Advisory Council Centennial Fellowship 297, CBA Foundation Advisory Council Centennial Fellowship 297, CBA Foundation Advisory Council Centennial Fellowship 297, CBA Foundation Advisory Council Centennial Fellowship 299, CBA Foundation Advisory Council Centennial Fellowship 303, CBA Foundation Advisory Council Centennial Fellowship 294, CBA Foundation Advisory Council Centennial Fellowship 284, Cba Foundation Advisory Council Centennial 143, Hal H. Bybee Memorial Fund 298, Hal P. Bybee Memorial Fund 1,797, Floyd A. Cailloux Centennial Professorship 348, Effie Marie Cain Regents Chair In Art 1,750, The Robert W. Calvert Faculty Fellowship In Law 180, Capitol City Savings Regents Professorship 533, Dave P. Carlton Centennial Professorship In Geology 2,067, Dave P. Carlton Centennial Professorship In 1,664, Liz Sutherland Carpenter Distinguished Visiting 605, Edwin W. Alyce 0. Carroll Centennial Lectureship In 205, Amon G. Carter Lectureship 103, Amon G. Carter, Jr. Centennial Professorship In 397, Amon G. Carter Centennial Professorship In 337, Lilia M. Casis Spanish Research Fund 37, Clifton W. Cassidy, Jr. Centennial Professorship In 188, Celanese Centennial Professorship 415, Centennial Commission Chair In The Liberal Arts 1,014, Estep,Lau, Noone And Van Colt Centennial Graduate 124, Centennial Professorship In Leadership For Community, 320, Century Club Professorship 901, Bennett Cerf Regents Professorship In Writing 868, The Chancellor'S Council Centennial Professorship In 413, The Chancellor'S Council Visiting Professorship 573, Chevron Lectureship In Petroleum Engineering 127, Gift Additions to Endowments Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,864, , , , , , , , , , , , ,150, , , ,731, , , , , , , , , , , , , , , , , , ,050, , , , , , , , , , , , , N , I
37 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 N OJ S. E. Clabaugh Fund In Hard-Rock Geology Charles And Dorothy Clark Lectureship In Fine Arts Ambassador Edward Clark Centennial Endowed Fellowship Edward Clark Centennial Professorship In Law Faculty Fellowship In Classics Centennial Professorship In Classical Archaeology Benjamin Clay1on Centennial Professorship In The Benjamin Clay1on Biochemical Institute Regents C. L. And Henriette F. Cline Centennial Visiting Bartlett Cocke Regents Professorship In Architecture Cockrell Family Regents Chair In Engineering # Cockrell Family Regents Chair In Engineering No Cockrell Family Regents Chair In Engineering No Cockrell Family Regents Chair In Engineering No Cockrell Family Regents Chair In Engineering # Cockrell Family Regents Chair In Engineering # Cockrell Family Regents Chair In Engineering # Cockrell Family Regents Chair In Engineering # Dula D. Cockrell Centennial Chair In Engineering Ernest Cockrell, Sr. Chair In Engineerin G Ernest Cockrell, Jr. Centennial Chair In Engineering Ernest And Virginia Cockrell Chair In Engineering Virginia H. Cockrell Centennial Chair In Engineering Wilbur J. Cohen Professorship In Health And Social George And Dawn L. Coleman Centennial Fellowship In Collie Lectureship Marvin K. Collie-Welch Regents Chair In Chemistry Everett D. Collier Centennial Chair In Communication Everett D. Collier Fellowship In Communication John P. Commons And Alice Mccarthy Commons Centennial John P. And Alice M. Commons Excellence Fund Computer Sciences Endowed Faculty Fellowship No Computer Sciences Endowed Faculty Fellowship No Computer Sciences Endowed Faculty Fellowship No Computer Sciences Endowed Faculty Fellowship No Computer Sciences Endowed Faculty Fellowship No Computer Sciences Endowed Faculty Fellowship No Computer Sciences Endowed Faculty Fellowship No Computer Sciences Endowed Faculty Fellowship No Computer Sciences Endowed Faculty Fellowship No Computer Sciences Endowed Faculty Fellowship No. 10 Net Position Gift Additions to September 1, 2012 Endowments 152, , , , , , , , , , , ,500, ,655, ,120, ,410, ,293, ,008, ,845, ,581, ,417, ,939, ,642, ,527, ,845, , , , ,449, ,545, , , , , , , , , , , ' , , Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 5, (26.51) 2, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , , , , , ' , , , Net Position August 31, , , , ,025, , , , , , , ,588, ,834, ,323, ,544, ,409, ,114, ,944, ,671, ,879, ,113, ,840, ,621, ,015, , , , ,570, ,599, , , , , , , , , , , , , ,485.44
38 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position September 1, Department Of Computer Sciences Administrative 6,030, Professorship In Computer Sciences #1 1,298, Professorship In Computer Sciences #2 1,141, Professorship In Computer Sciences #3 1,354, Professorship In Computer Sciences #4 1,683, Professorship In Computer Sciences #5 1,067, Regents Chair In Computer Sciences #1 1,906, Regents Chair In Computer Sciences #2 1,950, The Conocophillips Faculty Fellowship In Law 150, C. W. Cook Professorship In Environmental Engineering 682, Frances Crain Cook Endowed Lectureship In Education 66, Joe B. Cook Professorship In Business Administration 338, Joe B. And Louise Cook Professorship In Mathematics 370, Denton And Louise Cooley And Family Centennial 351, Denton A. Cooley Centennial Professorship In Zoology 316, Pricewaterhousecoopers Centennial Fellowship 285, Pricewaterhousecoopers Employees And Alumni 301, Fannie Coplin Regents Chair 1,956, Fred Thomson Couper, Jr. Research Professorship In 234, The Cox And Smith Incorporated Faculty Fellowship In 143, Ann Lacy Crain Centennial Endowed Lectureship 336, Bluford Walter Crain Centennial Endowed Lectureship 350, Thomas Mabry Cranfill Lectureship In Fine Arts 63, Thomas Mabry Cranfill Teaching Fellowship In English 163, Thomas Mabry Cranfill Teaching Fellowship In Spanish 161, Roberta P. Crenshaw Centennial Professorship In Urban 357, The Paul Phillippe Cret Centennial Teaching 195, Jack R. Crosby Regents Chair In Business 1,308, Joanne Sharp Crosby Regents Chair In Design And 1,256, Pauline Moss Crouch Scholarship 27, Trammell Crow Regents Professorship In Business 288, Trammell Crow Regents Professorship In Computer 481, Cullen Trust For Higher Education Endowed 712, Cullen Trust For Higher Education Endowed 716, Cullen Trust For Higher Education Endowed 815, Cullen Trust For Higher Education Endowed 721, Cullen Trust For Higher Education Endowed 837, Cullen Trust For Higher Education Endowed 697, Hugh Roy Cullen Centennial Chair In Business 3,277, Cullen Trust Centennial Professorship In Alcohol 312, Nina J. Cullinan Centennial Enrichment Fund In Fine 74, Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , ,256, , , ,347, , , ,184, , , ,405, , , , 788, , , ,158, , , ,978, , , ,023, , , , , , , , , , , , , , , , , , , , ,024, , , , , , , , , , , , , , , , , , , , ,354, , ,300, , , , , , , , , , , , , , , , , , , , , , , , , ,392, , , N 2, , <D
39 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 (...) W.A. Bill Cunningham Professorship Curriculum Development For The Department Of Computer Dads' Association Centennial Teaching Fellowship # Dads' Association Centennial Teaching Fellowship # Dallas Taca Centennial Fellowship In The Liberal Arts Dallas Taca Centennial Fellowship In The Liberal Arts Dallas Taca Centennial Professorship In The Dallas Taca Centennial Professorship In The Liberal Governor Bill Daniel Professorship In Archival Vara Martin Daniel Regents Professorship In Archives Morgan J. Davis Centennial Chair In Petroleum Geology Norris G. Davis Student Travel Fund Raymond F. Dawson Centennial Teaching Fellowship In G. B. Dealey Regents Professorship In Journalism Dean'S Scholar Susan Clark Leadership Award Fund Leroy G. Denman, Jr. Regents Professorship In Leroy G. Denman, Jr. Regents Professorship In Real Alexander Deussen Professorship Of Energy The Raymond Dickson, Alton C. Allen And Dillon Raymond Dickson Centennial Professorship # Raymond Dickson Centennial Professorship # Raymond Dickson Centennial Endowed Teaching Department Chairman'S Permanent Endowment For William I. Dismukes Fellowship In Pharmacy J. Frank Dobie Regents Professorship In American And R. P. Doherty, Sr. Centennial Professorship In R. P. Doherty, Jr.- Welch Regents Chair In Chemistry W. T. Doherty Professorship In Chemistry James T. Doluisio Centennial Fellowship James T. Doluisio Regents Professorship In Pharmacy Werner D. Dornberger Centennial Teaching Fellowship Angelina Dorsey Centennial Lectureship # Angelina Dorsey Centennial Lectureship # Angelina Dorsey Centennial Lectureship # Bob R. Dorsey Professorship In Engineering E. W. Doty Professorship In Fine Arts James R. Dougherty, Jr. Centennial Professorship In James R. Dougherty, Jr. Centennial Professorship In The Rachael Dougherty Vaughan Memorial Fund Arthur James Douglass Centennial Professorship In Donald J. Douglass Centennial Professorship In Net Position September 1, , , , , , , , , , , ,559, , , , , , , , ,255, , , , , , , , ,438, , , , , , , , , , , , , , , Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 12, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , , Net Position August 31, , , , , , , , , , , ,662, , , , , , , , ,299, , , , , , , , ,558, , , , , , , , , , , , , , ,151.69
40 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Joseph Paschal Dreibelbis Fellowship In Business 133, Joseph Paschal Dreibelbis Faculty Fellowship In Law 173, Juanita Dreibelbis Fellowship In Business 128, Minerva House Drysdale Regents Chair 2,028, Addison Baker Duncan Centennial Professorship In 342, Barbara Duncan Centennial Endowed Lectureship 186, Eckerd Centennial Professorship In Pharmacy 355, Stewart Turley/Eckerd Corporation Centennial Endowed 295, Carl J. Eckhardt Fellowship In Mechanical Engineering 159, Frank N. Edmonds, Jr. Regents Professorship In 353, Mary And J. Q. Edwards Centennial Lectureship In 61, Total Eandp Usa Petroleum Faculty Fellowship In 513, James A. Elkins Centennial Chair In Finance 2,214, John E. Brick Elliott Centennial Endowed 1,059, Samuel P. Ellison, Jr. Fund 308, Edward H. Ellms Graduate Seminar Room Endowment Royal B. Embree, Jr. Endowed Presidential Scholarship 211, , Energy And Mineral Resources Fund 103, Engineering Foundation Centennial Teaching Fellowship 189, Engineering Foundation Centennial Teaching Fellowship 255, Engineering Foundation Centennial Teaching Fellowship 250, Engineering Foundation Centennial Teaching Fellowship 178, Engineering Foundation Endowed Book Collection Archie W. Straiten Endowed Faculty Fellowship In 323, Temple Foundation Endowed Faculty Fellowship No , Temple Foundation Endowed Faculty Fellowship No.2 311, Temple Foundation Endowed Faculty Fellowship No , Temple Foundation Endowed Faculty Fellowship No.4 331, Temple Foundation Endowed Faculty Fellowship No.5 349, Temple Foundation Endowed Faculty Fellowship No.6 272, Temple Foundation Endowed Faculty Fellowship No.7 286, Engineering Foundation Endowed Lectureship No. 1 81, Engineering Foundation Endowed Lectureship No.2 92, Engineering Foundation Endowed Lectureship No Engineering Foundation Endowed Professorship #1 297, Temple Foundation Endowed Professorship No , Temple Foundation Endowed Teaching Fellowship In 342, Temple Foundation Endowed Teaching Fellowship In 294, Equipment Endowment For The Department Of Computer 293, Ernst And Young Distinguished Centennial Professorship 945, Ernst And Young Faculty Fellowship In Teaching 526, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31,2013 4, , , , , , , , , , , , , , , , , , , , , , , , , , ,292, , , ,102, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , c..>...
41 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than Stale As of August 31, 2013 w "' Frank C. Erwin, Jr. Centennial Fellowship Frank C. Erwin, Jr. Centennial Professorship In Fine Frank C. Erwin, Jr. Centennial Professorship In Drama Frank C. Erwin, Jr. Centennial Professorship In Frank C. Erwin, Jr. Centennial Honors Professorship Frank C. Erwin, Jr. Centennial Chair In Government Frank C. Erwin, Jr. Centennial Chair In State Frank C. Erwin, Jr. Centennial Professorship In Music Frank C. Erwin, Jr. Centennial Professorship In Opera Frank C. Erwin, Jr. Centennial Visiting Professorship John And Melba Estes Regents Research Professorship I. D. And Marguerite Fairchild Centennial Lectureship D. And Marguerite Fairchild Centennial Visiting Marguerite Fairchild Centennial Professorship George H. Fancher Centennial Teaching Fellowship In George H. Fancher Professorship In Petroleum William Stamps Farish Chair In Geology Phil M. Ferguson Centennial Teaching Fellowship In Phil M. Ferguson Lecture Series Fund In Structural Phil M. Ferguson Professorship In Civil Engineering Parker C. Fielder Regents Professorship In Music Parker Fielder Regents Professorship In Tax Law Stanley P. Finch Centennial Professorship In College Of Fine Arts Endowment Fund Carl Fink, Jr. Endowed Faculty Fellowship In Business Carl Fink, Jr. Lectureship Carl Fink, Jr. Endowed Faculty Fellowship In The J. Anderson Fitzgerald Centennial Fellowship Peter T. Flawn Centennial Chair In Geology Peter T. Flawn Centennial Professorship In Spanish Priscilla Pond Flawn Regents Professorship In Child Priscilla Pond Flawn Regents Professorship In Early Priscilla Pond Flawn Regents Professorship In Organ Fluor Centennial Teaching Fellowship In Engineering Fluor Centennial Teaching Fellowship In Engineering John A. Focht Centennial Teaching Fellowship In Civil Foley'S Professorship In Retailing The Fondren Foundation Centennial Chair In Business The Fondren Foundation Centennial Chair For Faculty The Fondren Foundation Centennial Chair In Physics Gerhard J. Fonken Director Of High Performance Net Position September 1, ,210, , , , , ,117, ,641, , , , , , , , , , ,344, , , , , , , ,416, , , , , ,273, ,087, '123, , , , , , , ,655, ,424, ,890, ,868, Gift Additions to Endowments Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 42, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions! Deductions , , , , , Net Position August 31,2013 1,252, , , , , ,192, ,734, , , , , , , , , , ,398, , , , , , , ,464, , , , , ,365, ,125, '163, , , , , , , ,713, ,474, ,956, ,024,744.12
42 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31,2013 Net Position Gift Additions to September 1, 2012 Endowments O'Neil Ford Centennial Chair In Architecture 2,218, Malcolm Forsman Centennial Professorship 350, Marion E. Forsman Centennial Professorship In 212, Foxworth Centennial Fellowship 168, Charles I. Francis Professorship In Law 262, W. H. Francis, Jr. Professorship 628, Judy Spence Tate Fellowship For Excellence 134, Clay B. Frederick-Rohm And Haas Endowment For Seminar 26, Friar Centennial Teaching Fellowship 684, E. Gus Fruh Visiting Professorship In Civil 250, Fulbright And Jaworski Regents Research Professorship 293, Jack H. Mayfield, Jr. Fund For Excellence In The 1 '156, , B. N. Gafford Professorship In Electrical Engineering 468, Lawrence D. Gale Chair In Small Business Management 1,603, , L. D., Marie And Edwin Gale Chair Of Judaic 1,530, , Rebecca L. Gale Regents Professorship In Business 268, Laverne Gallman Lectureship In Nursing 234, , Ellen Clayton Garwood Centennial Professorship In 657, W. St. John Garwood And W. St. John Garwood, Jr 1,044, Mary E. Gearing EndolfJ/ed Lectureship In Human Ecology 70, General Dynamics Endowed Faculty Fellowship 309, Generations Club Scholarship Endowment 188, General Motors Foundation Centennial Endowment For 125, General Motors Foundation Centennial Teaching 173, General Motors Foundation Centennial Teaching 116, Genetics Foundation-Genetics Memorial Fund 58, Geology Foundation Advisory Council Centennial 290, J. Ben Carsey, Sr. Special Maintenance Fund 446, , J. Donald Langston Special Operations Fund 709, Geology Foundation Excellence Fund 267, , Melvin H. Gertz Regents Chair In Chemical Engineering 2,830, Getty Oil Company Centennial Chair In Geological 2,794, Texaco Centennial Chair In Petroleum Engineering 1,979, Elizabeth Glenadine Gibb Teaching Fellowship In 149, Elizabeth Glenadine Gibb Teaching Fellowship In 141, The Cass Gilbert Centennial Teaching Fellowship In 196, Dr. Joe Thorne Gilbert Centennial Lectureship In 361, Marion Harris Thornberry Centennial Professorship In 320, June And Gene Gillis Endowed Faculty Fellowship In 366, L. P. Gilvin Centennial Professorship In Civil 388, Julius And Suzan Glickman Centennial Lectureship 218, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , ,296, , , , , , , , , , , , , , , , , , , , , , ,209, , , , , ,123, , ,587, , , , , , , , ,081, , , , , , , , , , , , , , , , , , , , (56.55) 1, , , , , , , , ,929, , , ,906, , ,048, , , , , , , , , , , , , , , en 7, , en
43 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 (.i)... Net Position Gift Additions to September 1, 2012 Endowments Earnest F. Gloyna Regents Chair In Engineering 4,397, Goleman And Rolfe Centennial Lectureship In 86, Richard J. Gonzalez Regents Chair In Economic 3,014, Tiny Gooch Centennial Professorship In Trial Practice 419, Gottesman Family Centennial Professorship In Computer 451, Graduate School Of Library And Information Science 222, The Graves, Dougherty, Hearon And Moody Centennial 144, Anne Green Regents Chair 1,718, John E. Green Regents Professorship In History 312, Herbert M. Greene Centennial Lectureship In 127, Dewitt C. Greer Centennial Professorship In 343, J. Nalle Gregory Chair In Sedimentary Geology 1,914, The Thomas W. Gregory Professorship 181, Lo'uise Spence Griffeth Fellowship For Excellence 139, Carol And Henry Groppe Professorship 366, Carol And Henry Groppe Undergraduate Advising Room 32, Chevron Centennial Teaching Fellowship In Chemical 160, Chevron Centennial Teaching Fellowship In Petroleum 157, Chevron Centennial Professorship In Geology 794, Chevron Centennial Fellowship In Business No , Chevron Centennial Fellowship In Business No , Chevron Centennial Fellowship In Engineering No , Chevron Centennial Fellowship In Engineering No.2 141, Norman Hackerman Professorship In Chemistry 964, Norman Hackerman- Welch Regents Chair In Chemistry 3,477, M. K. Hage Centennial Professorship In Education 346, M. K. Hage Centennial Visiting Professorship In Fine 159, M. K. Hage Centennial Visiting Professorship In Music 163, William W. Hagerty Fellowship In Engineering 142, Edward Everett Hale Centennial Professorship In 306, The Florence Thelma Hall Visiting Centennial 413, Florence Thelma Hall Centennial Chair In Music 884, , Alan W. Hamm Centennial Fellowship In Pharmacy 267, John P. Harbin Centennial Chair In Business 2,696, Harkins And Company Centennial Chair 3,149, H. B. Burt Harkins Professorship In Petroleum 367, H. Timothy Tim Harkins Centennial Professorship In 320, Harwell Hamilton Harris Regents Professorship In 491, Todd D. Harris Memorial Classroom Endowment 111, Edward H. Harte Lectureship In Latin America And The 69, Houston Harte Centennial Professorship In 393, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 155, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions 49, , , , , , Net Position August31, ,602, , ,120, , , , , ,778, , , , ,991, , , , , , , , , , , , ,001 ' ,653, , , , , , , ,415, , ,791, ,259, , , , , , ,608.63
44 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Isabel Mccutcheon Harte Centennial Chair In Astronomy 1,976, Janet F. Harte Lectureship In Population Issues 96, H. E. Hartfelder/The Southland Corporation Regents 1,497, H. E. Hartfelder/The Southland Corporation Regents 1,239, William H. Hartwig Fellowship In Electrical 164, L. D. Haskew Centennial Professorship In Public 789, Hayden Head Centennial Professorship 281, Hayden W. Head Regents Chair For Faculty Excellence 2,549, Hayden W. Head Regents Chair In The Plan li Honors 2,448, Ruth Head Centennial Professorship 458, William Randolph Hearst Endowment For Visiting 728, W. W. Heath Centennial Fellowship 611, Bess Heflin Centennial Professorship In Home 439, J. H. Herring Centennial Professorship In Petroleum 258, Mrs. Pearlie Dashiell Henderson Centennial Fellowship 168, H. R. Henze Teaching Excellence Award 63, The Wilson W. Herndon Memorial Faculty Fellowship In 133, J. H. Herring Centennial Professorship In Engineering 336, GeorgeS. Heyer Memorial Fund 347, F. J. Heyne Centennial Professorship In Communication 619, Archibald A. Hill Regents Professorship In American 296, Collins Hill, Jr. Fellowship 178, , John L. And Elizabeth G. Hill Centennial 305, Elizabeth Graham Hill Centennial Lectureship In Art 106, Ruben E. Hinojosa Regents Professorship In Education 330, History Of Music Chair 1,896, George H. Hitchings Regents Chair In Drug Design 1,809, William P. Hobby Centennial Professorship In 418, Claude R. Hocott Lectureship In Petroleum Engineering 254, , Gus M. Hodges Regents Research Professorship In Law 921, The Hoechst-Roussel Centennial Endowed Professorship 1,974, ViolaS. Hoffman And George W. Hoffman Lectureship In 105, Fred Hofheinz Regents Professorship In Economics 745, Lonnie F. Hollingsworth, Sr. Centennial Fellowship In 182, Sterling Clark Holloway Centennial Lectureship In 134, Houston Oil And Minerals Corporation Excellence 185, Annie Laurie Howard Regents Professorship In Fine 363, Iris Howard Regents Professorship In English 763, Clark Hubbs Regents Professorship In Zoology 501, T. Brockett Hudson/Joseph Magliolo, Jr. Endowment 634, T. Brockett Hudson Professorship In Chemical 859, , Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , ,046, , , , ,550, , ,282, , , , , , , , ,638, , ,534, , , , , , , , , , , , , , , , , , , , , , , , (581.91) , , , , , , , , , ,966, , ,873, , , , (3,153.35) , , , , ,044, , , , , , , , , , , , , , , , , , , , w 30, , , "1
45 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 "' Ol Net Position September 1, Emmett L. Hudspeth Centennial Lectureship In Physics 160, Baker Hughes Inc. Centennial Lectureship In 136, The Raytheon Company Faculty Fellowship 289, Baker Hughes Incorporated Centennial Professorship 692, Elton M. Hyder, Jr. And Martha Rowan Hyder Faculty 153, Carolyn Harris Hynson Centennial Visiting 322, ndustrial Properties Corporation Endowed Faculty 275, Information Systems Lectureship 196, F. Earl Ingerson Graduate Research Assistance Fund In 142, Admiral B. R. Inman Centennial Chair In Computing 5,190, Bank Of America Endowed Centennial Lectureship 144, John A. And Katherine G. Jackson Centennial Teaching 448, Paul C. Jackson Centennial Excellence Fund 97, George W. Jalonick Iii And Dorothy Cockrell Jalonick 354, Joseph D. Jamaii Centennial Chair In Law 1,034, The Lee Hage Jamail Regents Professorship In Fine 575, Lillie Hage Jamail Centennial Professorship 434, The Marie And Joseph D. Jamail, Sr. Regents 499, Leroy Jeffers Centennial Visiting Professorship In 158, Frank W. Jessen Centennial Fellowship In Petroleum 163, Frank W. Jessen Professorship In Petroleum 291, The Wolf And Janet Jessen Centennial Lectureship In 390, The Wolf And Janet Jessen Centennial Lectureship In 376, The Wolf And Janet Jessen Centennial Lectureship In 373, The Wolf And Janet Jessen Centennial Lectureship In 374, Johnson And Johnson Centennial Chair In Plant Cell 3,289, Johnson And Johnson Centennial Chair In Pharmacy 2,679, Johnson And Johnson Centennial Professorship In 824, Luci Baines Johnson Fellowship In Nursing 227, Luci B. Johnson Centennial Professorship In Nursing 390, Lyndon B. Johnson Centennial Chair In National Policy 4,746, Murray S. Johnson Chair In Economics 8,599, Richard J. V. Johnson-Welch Regents Chair In 6,758, Bess Harris Jones Centennial Professorship In Natural 336, Jesse H. Jones Regents Professorship In Fine Arts 627, Jesse H. Jones Regents Professorship In Liberal Arts 700, Jesse H. Jones Centennial Chair In Communication 1,890, Jesse H. Jones Centennial Professorship In 677, Jesse H. Jones Fellowship In Communication 158, Jesse H. Jones Professorship In The Graduate School 330, Jesse H. Jones Professorship In Journalism 589, Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 5, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions 30, , , , , (3,682,959.33) Net Position August 31, , , , , , , , , , ,383, , , , , ,071, , , , , , , , , , , ,405, ,773, , , , ,913, ,901, ,218, , , , ,957, , , , ,826.84
46 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position September 1, John T. Jones, Jr. Centennial Professorship In 624, Mrs. Mary Gibbs Jones Centennial Chair In 1,497, Mrs. Mary Gibbs Jones Fellowship In Communication 158, Barbara Jordan Fund 2,270, Jack S. Josey- Welch Foundation Chair In Science 5,215, JackS. Josey Professorship In Energy Studies 526, Josey Centennial Professorship In Astronomy 350, Josey Centennial Professorship In Energy Resources 401, Karl Kamrath Lectureship In Architecture 203, George T. Karpos/Friends Of Alec Excellence Fund 41, John E. Kasch Endowed Faculty Fellowship In 292, W. Page Keeton Chair In Tort Law 534, Herbert D. Kelleher Centennial Professorship In 493, Herbert D. Kelleher/Mcorp Regents Professorship In 520, Joan Negley Kelleher Centennial Professorship In 545, The Lorene Morrow Kelley Lectureship 167, Lorene Morrow Kelley Lectureship In Molecular Biology 214, W. K. Kellogg Professorship Of Community College 355, Lorene Morrow Kelley Professorship In Microbiology 813, Kelly, Hart And Hallman Regents Faculty Fellowship In 138, Harry L. Kent, Jr. Professorship In Mechanical 252, MartinS. Kermacy Centennial Professorship In 450, Kerr-Mcgee Petrophysics Laboratory 67, Mildred Caldwell And Baine Perkins Kerr Centennial 2,032, Mildred Caldwell And Baine Perkins Kerr Centennial 365, Barron Ulmer Kidd Centennial Lectureship 147, Jack Kilby/Texas Instruments Endowed Faculty 1,468, Sue Killam Professorship In The Foundations Of 444, Alfred A. And Ellen U. King Centennial Lectureship 135, Alfred A. And Ellen U. King Centennial Lectureship In 150, The Joe King Professorship 416, Robert D. King Centennial Professorship Of Liberal 621, Kleberg-King Ranch Centennial Professorship In 781, Clifford L. Klinck, Jr. Centennial Professorship In 395, Carolyn G. And G. Moses Knebel Teaching Fund 330, Malcolm Knowles Centennial Lectureship 64, Kenneth A. Kobe Professorship In Chemical Engineering 492, Henry E. Singleton Endowed Research Fellowship 129, George A. Roberts Endowed Research Fellowship 129, Gerhard J. Fonken Endowed Research Fellowship 129, Jack S. Blanton Endowed Research Fellowship 129, Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , ,550, , , , ,350, , ,398, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,1 00, , , , , , , ,533, , , , , , , , , , , , , , , , , , , , , , , , , , , , , _, w
47 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 w 00 Net Position Gift Additions to September 1, 2012 Endowments Cynthia Hendrick Kozmetsky Endowed Research 129, Michael Scott Endowed Research Fellowship 129, George Kozmetsky Centennial Chair 3,873, Gregory A. Kozmetsky Centennial Fellowship 1,801, George And Ronya Kozmetsky Centennial Lectureship 605, Ronya Kozmetsky Centennial Lectureship For Women In 482, Leonardi F. Kreisle Senior Design Project Teaching 134, W. James Krenzer Chair In Trial And Appellate 1,312, Lamar Savings Centennial Professorship In Finance 643, B. J. Lancaster Professorship In Petroleum 305, The Sylvan Lang Professorship 283, Clara Jones Langston Centennial Lectureship In 82, Clara Jones Langston Centennial Lectureship In Drama 63, Wann And Marietta Langston Research Fund In 359, La Quinta Motor Inns, Inc. Centennial Professorship 321, La Quinta Motor Inns, Inc. Centennial Professorship 378, Jack K. Larsen-Mesa Petroleum Company Fund In 511, Robert Adger Law And Thos. H. Law Centennial 301, Thos. H. Law Centennial Professorship In Law 443, Quincy Lee Centennial Professorship In Business 203, Quincy Lee Centennial Professorship In Computer 392, Mary Saunders Leech Centennial Lectureship 123, Charles A. Lemaistre Centennial Fellowship 605, Liberal Arts Foundation Centennial Professorship 610, Barbara Pierce Bush Regents Professorship In Liberal 255, Frank A. Liddell, Jr. Centennial Fellowship In 326, Frank A. Liddell, Sr. Centennial Professorship In 635, J. Hugh And Betty Liedtke Centennial Fellowship In 153, Eli Lilly And C. R. Sublett Centennial Fellowship In 265, Gordon Lippitt Centennial Lectureship 76, George W. Littlefield Centennial Lectureship In 436, George W. Littlefield Professorship In American 645, Locke Liddell And Sapp Lip Faculty Fellowship In Law 133, Josleen Lockhart Memorial Fund 56, Thomas A. Loomis Endowed Lectureship 266, Ben F. Love Chair In Bank Management 2,454, Ben F. Love Regents Professorship In Communication 606, Howard R. Lowe Vertebrate Paleontology Endowment 119, Charles W. Lubbock Friend Of Alec Excellence Fund 94, C. L. Lundell Chair Of Systematic Botany 2,215, Walter W. Mcallister Centennial Chair In Financial 2,878, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 4, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , Net Position August 31, , , ,009, ,864, , , , ,358, , , , , , , , , , , , , , , , , , , , , , , , , , , , ,540, , , , ,293, ,979,492.95
48 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments David And Doris Lybarger Endowed Faculty Fellowship 293, Staley And Beverly Mcbrayer Endowed Fund In Community 76, E. C. Mccarty Centennial Professorship 311, Charles Tilford Mccormick Professorship Of Law Susan Taylor Mcdaniel Regents Professorship In 1 '119, Susan Taylor Mcdaniel Regents Professorship In 1,017, Eugene Mcdermott Centennial Visiting Professorship 376, Eugene And Margaret Mcdermott Excellence Fund For The 92, Margaret Mcdermott Centennial Teaching Fellowship In 182, The Margaret And Eugene Mcdermott Centennial 485, John P. Mcgovern Centennial Award Lectureship In 158, John P. Mcgovern Regents Professorship In Health And 472, John J. Mcketta Centennial Energy Chair In 3,113, John J. Mcketta Energy Professorship In Engineering 351, John Mcketta Aiche Student Chapter Room 45, John Mcketta Student Study Hall 31, The R. A. Mcketta Che Tutoring Room 37, Amy Johnson Mclaughlin Centennial Professorship In 399, The Marrs Mclean Professorship In Law 270, Laurence E. Mcmakin, Jr. Centennial Fellowship In 164, George P. Macatee, Iii Centennial Lectureship #1 83, George P. Macatee, Iii Centennial Lectureship #2 80, George P. Macatee Iii Centennial Lectureship No.3 75, George P. Macatee Iii Centennial Lectureship No.4 74, Alma Cowden Madden Centennial Professorship 667, , John E. Mahler Endowment Fund In Chemistry 99, Alfred And Dorothy Mannino Fellowship In Pharmacy 139, F. A. Matsen Endowed Regents Lectureship On The 144, Curtis Mathes Memorial Fellowship 270, Thomas Shelton Maxey Professorship 991, L. B. Preach Meaders Professorship In Engineering 474, Meadows Foundation Centennial Fellowship In 168, Meadows Foundation Centennial Professorship In 335, Meadows Foundation Centennial Professorship In The 659; Paul D. And Betty Robertson Meek And American 327, Paul D. And Betty Robertson Meek And American 259, Paul D. And Betty Robertson Meek Centennial 308, Paul D. And Betty Robertson Meek Centennial 461, Andrew W. Mellon Foundation Faculty Fellowship In 1,379, Alice Kleberg Reynolds Meyer Foundation Centennial 331, Marlene And Morton Meyerson Centennial Chair 1,028, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , , , , , , , , ,158, , ,053, , , , , , , , , , , , , , ,222, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,026, , , , , , , , , , , , , , , , , , ,428, , , w 36, ,065, <0
49 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31,2013-1>- 0 Net Position Gift Additions to September 1, 2012 Endowments Marlene And Morton Meyerson Centennial Professorship 713, Marlene And Morton Meyerson Centennial Professorship 359, Marlene And Morton Meyerson Centennial Professorship 655, Sidney E. Mezes Fund 211, Marl Sabusawa Michener Regents Chair In Writing Coli 1,439, Johann Friedrich Miescher Regents Professorship In 393, Grace Hill Milam Centennial Fellowship In Fine Arts 293, J. R. Millikan Centennial Professorship In English 338, Ruth Knight Millikan Centennial Professorship 339, Bob Mitchell Friend Of Alec Excellence Fund 46, Robert And Jane Mitchell Endowed Faculty Fellowship 331, W. A. Monty Moncrief Centennial Chair In Petroleum 1,789, W. A. Tex Moncrief, Jr. Centennial Chair In Petroleum 1,776, Paul V. Montgomery Centennial Memorial Professorship 386, Paul V. Montgomery Centennial Memorial Professorship 1 '180, TheW. L. Moody, Jr. Centennial Professorship In 659, Fred H. Moore Endowed Centennial Lectureship 184, Fred H. Moore Centennial Professorship In 670, Gordon S. Moore Faculty Fellowship In Taxation 284, Harry Moore Centennial Endowed Lectureship 73, R. L. Moore Centennial Lectureship In Mathematics 387, Marie Betzner Morrow Centennial Chair 3,037, Mary M. Betzner Morrow Centennial Chair In 1,860, The Wright C. Morrow Professorship 268, Betty And Glenn Mortimer Centennial Professorship In 1,417, Eleanor T. Mosie Fellowship 143, J. Ludwig Mosie Centennial Memorial Professorship In 715, Motorola Regents Chair In Electrical And Computer 5,390, Clint W. Murchison, Sr. Chair Of Free Enterprise 6,237, John D. Murchison Regents Professorship In Art 434, John D. Murchison Fellowship In Art 130, John D. Murchison Fellowship In Fine Arts 130, Virginia L. Murchison Regents Professorship In Fine 696, William J. Bill Murray, Jr. Endowed Chair Of 3,407, William J. Murray, Jr. Fellowship In Engineering No 144, William J. Murray, Jr. Fellowship In Engineering No 146, William J. Murray, Jr. Fellowship In Engineering #3 162, William J. Murray, Jr. Fellowship In Engineering #4 164, Audrey Rogers Myers Centennial Professorship In 371 ' Mike A. Myers Centennial Professorship In Computer 430, Frances Higginbotham Nalle Centennial Professorship 334, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 25, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , , Net Position August 31, , , , , ,490, , , , , , , ,852, ,839, , ,221, , , , , , , ,144, ,925, , ,466, , , ,639, ,456, , , , , ,552, , , , , , , ,961.12
50 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments C. Wayne Nance Friend Of Alec Excellence Fund 40, College Of Natural Sciences Foundation Advisory 241, College Of Natural Sciences Centennial Undergraduate 390, Joe W. Neal Centennial Fellowship In International 166, , Judson Neff Centennial Fellowship 614, Torn E. Nelson, Jr. Regents Professorship In Business 584, V. F. Neuhaus Centennial Professorship In Finance 666, First George H. Newlove Endowed Faculty Fellowship In 284, Second George H. Newlove Endowed Faculty Fellowship 265, Jon NeW1on Centennial Fellowship 605, Harold C. And Alice T. Nowlin Regents Professorship 322, Wade T. And Bettye C. Nowlin Centennial Professorship 279, W. Albert Noyes, Jr. Distinguished Visiting 103, Dennis O'Connor Regents Professorship In Business 332, Peter O'Donnell, Jr. Centennial Chair In Computing 5,862, Peter O'Donnell, Jr.-Friend Of Alec Excellence Fund 27, Fred L. And Frances J. Oliver Lectureship In Texas 234, Will E. Orgain Lectureship 39, Judd H. And Cynthia S. Oualline Centennial 265, Judd H. And Cynthia S. Oualline Centennial 256, Judd H. Oualline Endowment Fund 77, ArthurW. Page Faculty Fellowship In Public Relations 147, ArthurW. Page Lectureship In Public Relations 161, Page Southerland Page Fellowship In Architecture 149, T. S. Painter Centennial Professorship In Genetics 414, Pfizer Centennial Professorship In Pharmacy 310, Catherine Mae Parker Centennial Professorship In 263, Foster Parker Centennial Professorship Of Finance And 1,400, Robert L. Parker, Sr. Centennial Professorship In 396, J. R. Parten Chair In The Archives Of American 1,946, Charlotte Maer Patton Centennial Fellowship In 152, B.!den Payne Fund 35, Bill R. Payne Centennial Teaching Fellowship 301, Joyce Bowman Payne Centennial Teaching Fellowship 283, Kpmg Centennial Fellowship In Accounting 283, Kpmg Centennial Professorship 1,347, Kpmg Faculty Fellowship In Accounting Education 572, Pennzoil Company Regents Professorship In Mathematics 416, Rowland Pettit Centennial Professorship In Chemistry 1,207, Rowland Pettit Centennial Visiting Professorship 289, Scott Petty Geophysical Fund 632, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31,2013 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,080, , , , , , , , , , , , , , , , , , , , , , , , , ,449, , , , ,014, , , , , , , , , , , , , , ,394, , , , , , ,250, , , , , , :::
51 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, \) ""'" Net Position Gift Additions to September 1, 2012 Endowments Edmund L. Pincoffs Faculty Fellowship In Philosophy 401, Ruby Lee Piester Centennial Professorship In Services 283, Pioneer Corporation Faculty Fellowship On Petroleum 129, Louis T. Pirkey Centennial Lectureship 141, , Sylvain Pirson Centennial Lectureship In Petroleum 101, James L. And Nancy Powell Centennial Professorship In 874, Harry H. Power Professorship In Engineering 84, Wallace E. Pratt Professorship In Geophysics 631, Kenneth And Emma-Stina Prescott Lectureship In 20Th 143, The President'S Associates Centennial Fellowship In 173, The President'S Associates Centennial Teaching 186, Pricewaterhousecoopers Centennial Professorship In 927, Ashley H. Priddy Centennial Professorship In 333, , Charles And Elizabeth Prothro Regents Chair In 3,167, Wayne H. Holtzman Regents Chair In Psychology 1,318, Quantum Chemical Corporation Endowed Faculty 350, Oliver H. Radkey Regents Professorship In History 264, Cooper K. Ragan-Regents Professorship In Law 459, Susan Menefee Ragan Regents Professorship In Fine 330, Edward Randall, Jr., M.D. Centennial Professorship In 345, B. M. Mack Rankin, Jr. Professorship In Business 507, Harry H. Ransom Centennial Fellowship 1,210, Audre And Bernard Rapoport Regents Chair Of Jewish 2,147, Rapoport Centennial Professorship Of Liberal Arts 684, Audre And Bernard Rapoport Centennial Chair In 2,621, Rashid Engineering Regents Chair 3,357, Roberta Woods Ray Centennial Fellowship In 154, Dewitt C. Reddick Centennial Lectureship In 132, Dewitt C. Reddick Regents Chair In Communication 1,930, , JohnS. Redditt Professorship In State And Local 264, Dwight W. And Blanche Faye Reeder Centennial 332, The William H. And Gladys G. Reeder Fellowship In 332, Regents Chair In Higher Education Leadership 4,562, Jackson B. And Avis B. Reid Educational Psychology 57, Carl Ernest And Mattie Ann Muldrow Reistle, Jr 157, Bank Of America Centennial Professorship In Petroleum 523, Bank Of America Centennial Professorship In Business 360, Revco Foundation Fellowship In Pharmacy 165, Rgk Foundation Centennial Fellowship 150, Lillian And Tom B. Rhodes Centennial Teaching 168, Lillian And Tom B. Rhodes Centennial Teaching 176, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 14, , , , , , , , , , , , , (69.29) 111, , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , (1,323,970.25) , Net Position August 31, , , , , , , , , , , , , , ,278, ,364, , , , , , , ,252, ,223, , ,356, ,475, , , ,003, , , , ,732, , , , , , , , ,707.25
52 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Lillian And Tom B. Rhodes Centennial Teaching 180, Lillian And Tom B. Rhodes Centennial Teaching 178, Katherine Ross Richards Centennial Teaching 200, Katherine Ross Richards Centennial Teaching 212, The Sid W. Richardson Centennial Professorship In 377, Sid W. Richardson Regents Chair In Community College 3,331, Sid W. Richardson Foundation Regents Chair In 3,982, Sid W. Richardson Foundation Regents Chair In 3,312, Sid W. Richardson Foundation Regents Chair In 4,134, Sid W. Richardson Foundation Regents Chair In 3,765, Sid W. Richardson Foundation Regents Chair In Physics 3,997, Sid W. Richardson Foundation Regents Chair In Physics 3,647, Sid W. Richardson Foundation Regents Chair In Physics 4,070, Sid W. Richardson Foundation Regents Chair In Physics 5,022, Richardson Savings And Loan Association Centennial 283, Eugene A. Ripperger Lectureship In Engineering 89, Tomas Rivera Regents Professorship In Spanish 785, Alfred W. Roark Centennial Professorship In Natural 458, Royston M. Roberts Fellowship In Chemistry 110, Mr. And Mrs. Corbin J. Robertson, Sr. Regents Chair 8,414, Lorene L. Rogers Excellence Fund And Endowed 134, Gerard A. Rohlich Regents Professorship In Civil 221, Stanley D. And Sandra Rosenberg Centennial 451, Stanley D. And Sandra J. Rosenberg Centennial 217, Elspeth Rostow Centennial Fellowship 659, , C. E. Rowe Memorial Fund Endowment 30, Charles Elmer Rowe Fellowship In Engineering 143,241 " Darrell K. Royal Regents Professorship In Ethics And 1,371, H. Grady Rylander Longhorn Mechanical Engineering 50, Zettie W. Cole Salathe Fund In Child Development 87, George I. Sanchez Centennial Professorship In Liberal 490, Charles Sapp Centennial Professorship In 581, Fayez Sarofim And Co. Centennial Fellowship #1 149, Fayez Sarofim And Co. Centennial Fellowship No.2 142, Fayez Sarofim And Co. Centennial Professorship In 321, Schlumberger Centennial Chair In Computer Sciences 3,676, Schlumberger Centennial Chair In Electrical 2,806, Edwin A. Schneider Centennial Lectureship In 152, E. P. Schoch Professorship In Engineering 346, Nadya Kozmetsky Scott Centennial Fellowship 1,856, Wilton E. Scott Centennial Professorship 880, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31,2013 6, , , , , , , , , , , ,448, , ,122, , ,429, , , ,294, , , ,910, , ,137, , ,776, , , ,223, , , ,241, , , , , , , , , , , , , ,733, , , , , , , , , , , , , , , , ,419, , , , , , , , , , , , , , , , , ,815, , ,905, , , , , , ,921,791 "12 30, , ,286.36,!>. w
53 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 t Net Position Gift Additions to September 1, 2012 Endowments Z. T. Scott Family Chair In Drama 1.295, Eddy Clark Scurlock Centennial Professorship In 2,149, Tom Sealy Centennial Research Professorship In Energy 362, Tom Sealy Lecture On Law And The Free Society 57, Richard Seaver Centennial Fellowship 605, Charles And Sarah Seay Regents Professorship In 483, Margie Gurley Seay Centennial Professorship In 441, Sarah M. And Charles E. Seay Regents Professorship In 637, William H. Seay Centennial Professorship In Business 482, Rex A. Sebastian/Dresser Foundation Centennial 218, Rex A. And Dorothy B. Sebastian Centennial 307, Deloitte And Touche Centennial Faculty Fellowship In 291, Deloitte And Touche Centennial Faculty Fellowship In 276, Deloitte And Touche/Curtis H. Cadenhaed Centennial 205, Jacques P. Servier Regents Professorship In Pharmacy 334, Shakespeare At Winedale Regents Professorship 636, Sharpe Centennial Fellowship 160, Ernest A. Sharpe Centennial Professorship In 616, The George And Diana Sharpe Perinatal Lectureship 148, Alice Jane Drysdale Sheffield Regents Chair 2,878, Alice Jane Drysdale Sheffield Regents Professorship 558, Earl E. Sheffield Regents Chair 2,820, Earl E. Sheffield Regents Professorship In History 331, William J. Sheffield Centennial Endowed Professorship 457, Shell Companies Foundation Distinguished Chair In 2,776, Shell Companies Foundation Centennial Chair In 3, 163, Preston Shirley Faculty Fellowship In Law 203, William Shive Centennial Professorship In 507, Allan Shivers Centennial Chair In Communication 1,925, Allan Shivers Fellowship In Communication 157, Byron E. Short Lectureship In Mechanical Engineering 81, D. J. Sibley Centennial Professorship In Plant 1 '159, Silver Spurs Centennial Teaching Fellowship No.1 202, Silver Spurs Centennial Teaching Fellowship No.2 209, Carroll D. Simmons Centennial Teaching Fellowship In 209, Tom Slick Memorial Trust For The University OfTexas 9,239, Russell Upson Smith Family Endowment 216, , C. Aubrey Smith Accounting Educational Endowment Fund 283, C. Aubrey Smith Professorship In Accounting 370, Bryant Smith Chair In Law 242, C. Aubrey Smith Center For Auditing Education And 872, , Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , ,341, , ,224, , , , , , , , ,910,76 15, , , , , , , , , , , , , , , , , , , , , , , , , , , ,979, , , , ,919, , , , , , , , ,888, , , ,290, , , , , , ,992, , , , , , ,200, , , , , , , , , ,651, , , , , , , , , , ,750.09
54 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments C. B. Smith, Sr. Centennial Chair #1 In United 3,424, C. B. Smith, Sr. Centennial Chair In United 3,139, C. B. Smith, Sr. Centennial Chair In United 2,281, C. B. Smith, Sr. Centennial Chair In United 2,224, C. B. Smith, Sr., Nash Phillips, Clyde Copus 3,002, Ed And Molly Smith Centennial Professorship In 351, Ed And Molly Smith Centennial Fellowship In Nursing 213, Ed And Molly Smith Chair In Business Administration 1,237, Ed And Molly Smith Fellowship In Nursing 184, Eugene R. Smith Centennial Research Professorship In 295, Mr. And Mrs. A. Frank Smith, Jr. Regents Chair In 6,049, Harlan J. Smith Centennial Professorship In Astronomy 351, Smithkline Centennial Professorship In Pharmacy 369, The Lowber Snow Fund Of The Engineering Foundation 41, Southwestern Bell Foundation Endowed Professorship In 917, Southwestern Drug Corporation Centennial Fellowship 150, Mary John And Ralph Spence Centennial Professorship 545, Charles H. Spence Centennial Professorship In 423, The William R. Spriegel Centennial Fellowship 150, Stephen H. Spurr Centennial Fellowship 384, , The Esther L. Stallmann Lecture Fund 49, Robert And Francis Stark Centennial Fellowship In 161, Ernest W. Steel Lectureship In Environmental Health 101, Lorraine I. Stengl Endowment Fund 432, Stiles Professorship In American Studies 400, Stiles Professorship In Humanities And Comparative 543, Fiona D. Stokes Centennial Teaching Fellowship In 175, William T. Stokes Centennial Teaching Fellowship In 491, Leon Stone Centennial Professorship In Commercial 406, Helen Strauss Regents Professorship In Writing 763, Structural Geology And Tectonics Fund 329, , Barbara White Stuart Centennial Professorship In 312, Daniel B. Stuart Centennial Professorship In The 751, John T. Stuart Iii Centennial Professorship In 280, John T. Stuart Iii Centennial Chair In Business 1,218, John T. Stuart Iii Centennial Professorship In 268, Melissa Elizabeth Stuart Centennial Professorship In 386, Student Council Endowed Teaching Award 81, Student Engineering Gift Campaign Endowment 66, George W. And lone Sturnberg Research Professorship In 452, Bobbie And Coulter R. Sublett Centennial 395, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , ,544, , ,249, , ,361, , ,302, , , 108, , , , , , ,280, , , , , , , ,274, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,261, , , , , , , , , , , , , ()'1 ""
55 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013.j>. Ol Coulter R. Sublett Chair In Pharmacy Oryx Energy Company Centennial Fellowship No.1 In Oryx Energy Company Centennial Fellowship No. 21n The Superior Oil Company-Linward Shivers Centennial Susman Godfrey Endowed Moot Court Competition Robert Lee Sutherland Chair In Mental Health And Judson S. Swearingen Regents Chair In Engineering Mary Lee Harkins Sweeney Centennial Professorship In Alice Mackie Scott Tacquard Centennial Lectureship Alice Mackie Scott Tacquard Centennial Lectureship In Taro Tamura Memorial Fund For Ut-Japan Collaboration Elizabeth Tarpley Regents Fellowship In Textiles And Jack G. Taylor Centennial Professorship Jack G. Taylor Regents Professorship In Business Jack G. Taylor Lectureship In Fine Arts Jack G. Taylor Endowment Fund Jack G. Taylor Regents Professorship In Fine Arts T. U. Taylor Professorship In Engineering Teeple Partners, Inc. Lectureship In Business Larry And Louann Temple Centennial Professorship In Louann And Larry Temple Centennial Professorship In Temple Teaching Fellowship Alexander Watkins Terrell Centennial Lectureship Texas Atomic Energy Research Foundation Centennial Texas Atomic Energy Research Foundation Professorship Texas Atomic Energy Research Foundation Professorship Antoinette De Vaucouleurs Centennial Lectureship In Texas Commerce Bancshares, Inc. Centennial Texas Chair In Czech Studies Texas Commerce Bancshares, Inc. Centennial Texas Exes In Human Ecology Centennial Lectureship Human Ecology Special Activities Fund William C. Jennings, Sr. Professorship Of Real Estate Texas Union Lectureship In Student Leadership Joanne Thaman Dissertation Fellowship Theater For Youth Chair Ralph B. Thomas Regents Professorship In Asian Ralph B. Thomas Regents Professorship In The Wilton E. And Catherine A. Thomas Professorship J. Neils Thompson Centennial Teaching Fellowship In Joe C. Thompson Centennial Professorship In Net Position September 1, ,327, , , , , ,343, ,662, , , , , , ,270, , , , , , , , , , , , , , , , ,442, , , , , , , ,593, , , , , , Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) In Fair Income (Realized Value of Gains and Investments Losses) 46, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , Net Position August 31, ,374, , , , , ,426, ,890, , , , , , ,315, , , , , , , , , , , , , , , , ,528, , , , , , , ,652, , , , , ,070.08
56 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Joe C. Thompson Centennial Professorship In Retail 232, M. J. Thompson Regents Professorship In Aerospace 255, Mary Helen Thompson Centennial Professorship In The 460, Journalism Department, Paul J. Thompson-Dewitt C 178, Thompson And Knight Centennial Professorship In Law 288, Eli H. And Ramona Thornton Centennial Fellowship In 154, Los Angeles Times Centennial Visiting Professorship 264, Los Angeles Times Centennial Visiting Professorship 189, Edward Larocque Tinker Chair In Latin American 1,861, Beatrice M. Tinsley Centennial Visiting Professorship 1,033, Tobin International Geological Map Collection Fund 286, Toreador Trust Fund For Salary Supplementation 1,573, Deloitte And Touche Professorship In Accounting 454, Trice Professorship In Plan Ji 1,347, Trull Centennial Professorship In Physics #1 321, Trull Centennial Professorship In Physics No.2 309, Robert B. Trull Chair In Engineering 932, Robert B. Trull Lectureship In Engineering 55, W. T. Tommy Tucker Excellence Fund In Marketing 43, Matthew Van Winkle Regents Professorship In Chemical 339, Glenn And Martha Vargas Endowment For Gems And Gem 191, Curtis T. Vaughan, Jr. Centennial Chair In Astronomy 2,609, Rachael And Ben Vaughan Faculty Fellowship In 147, Roy Allison Vaughan Centennial Professorship In 276, Louis Nicolas Vauguelin Regents Professorship In 402, Jesse J. Villarreal Centennial Fellowship In Speech 170, Visiting Artists Chair 2,891, Vista Chemical Company Regents Endowed Lectureship In 131, Leslie Waggener Centennial Teaching Fellowship 160, Leslie Waggener, Sr. Centennial Teaching Fellowship 157, Leslie Waggener Professorship In The College Of Fine 362, A. W. Walker Centennial Chair 3,344, E. D. Walker Centennial Fellowship 605, Myrtle And Earl Walker Fund 395, Neill B. Walsdorf Fellowship In Pharmacy 189, Joe C. Walter, Jr. Chair In Engineering 1 '703, Joseph C. And Elizabeth C. Walter, Jr. Geology Library 1,462, , Bernard J. Ward Centennial Professorship 429, Philip G. Warner Regents Professorship In 625, George S. Watson Centennial Professorship In Real 560, George W. Watt Centennial Professorship 344, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August31, , , , (231,356.79) 33, , , , , , , , , , , , , , ,926, , ,069, , , , ,628, , , , , ,490, , , , , , , , , , , , , , , , ,700, , , , , , , , , , , ,998, , , , , , , , , , , ,590, , , , , , , , , ,762, , , ,519, , , , , , , !>- 12, , ,J
57 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013.j>. co Net Position Gift Additions to September 1, 2012 Endowments George And Pauline Watt Centennial Lectureship 115, Walter Prescott Webb Chair In History And Ideas 3,850, David Wechsler Regents Chair In Psychology 2,845, Albert W. And Alice M. Weeks Centennial Professorship 603, M. Harvey Weil Centennial Endowed Lectureship In 82, The Robert A. Welch Chair In Chemistry 3,264, C. T. Wells Professorship In Project Management 477, Glenn A. Welsch Centennial Professorship In 1,314, William Robertson Welty Fund For Engineering 66, John Arch White Professorship In Business 379, Mastin Gentry White Professorship In Southern History 999, Roy And Grace Whittenburg Centennial Faculty 131, Mr. N. Doug Williams Memorial Centennial Fellowship 158, The Roger J. Williams Endowment For Biochemical 46, Roger J. Williams Centennial Professorship In 487, The Robert B. Williamson Memorial Excellence Fund 32, Clara Pope Willoughby Centennial Professorship In 351, Clara Pope Willoughby Centennial Professorship In 697, , John A. Wilson Professorship In Vertebrate 585, , Sonia Wolf Wilson Lectureship In Home Economics 192, Winstead PC Faculty Fellowship in Law 138, Louis And Ann Wolens Centennial Chair In Gerontology 1,907, Sam P. Woodson, Jr. Centennial Memorial Professorship 328, W. R. Woolrich Professorship 418, Annabel Irion Worsham Centennial Professorship 385, Gus Wortham Memorial Chair In Risk Management And 3,714, Jack D. Wrather, Jr. Centennial Fellowship 614, Bonita Granville Wrather Centennial Fellowship 610, Mr. And Mrs. William F. Wright, Jr. Centennial 342, Fred And Emily Marshall Wulff Centennial Chair In Law 1,295, Angus G. Wynne, Sr. Professorship In Civil 263, William Benjamin Wynne Professorship In Law 400, The First Mr. And Mrs. Charles E. Yager Professorship 486, The Second Mr. And Mrs. Charles E. Yager 472, The Third Mr. And Mrs. Charles E. Yager Professorship 595, Samuel T. And Fern Yanagisawa Regents Professorship 352, Ralph W. Yarborough Centennial Professorship Of 303, Alice Mckean Young Regents Chair In Law 1,562, Ernst And Young Accounting Education Excellence Fund 1,453, , Ernst And Young Faculty Fellowship In Accounting 279, Louis T. Yule Regents Professorship In Library And 385, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 4, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions 2.00 (149,818.61) , E;> 6.0( , , , , , Net Position August 31, , ,754, ,945, , , ,379, , ,360, , , ,034, , , , , , , , , , , ,974, , , , ,845, , , , ,340, , , , , , , , ,617, ,629, , ,793.71
58 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Zale Corporation Centennial Fellowship In Retail 150, Zale Corporation Centennial Teaching Fellowship In 139, Zale Corporation Centennial Professorship In Business 334, Zarrow Centennial Professorship In Engineering 550, Zarrow Centennial Professorship In Petroleum 345, Erich W. Zimmermann Regents Professorship In 339, Charles T. Zlatkovich Centennial Professorship In 674, Charles B. Grant Endowment In Engineering 61, G. Rollie White Teaching Excellence Chair In Law 1,767, Arthur L. Moiler Chair In Bankruptcy Law And Practice 916, Cullen Trust For Higher Education Endowed 747, Keys And Joan Curry/Cullen Trust Endowed Chair 1,464, Strawbridge Classroom 24, George Christian Centennial Professorship 692, Dow Chemical Company Faculty Fellowship In Technical 457, The Tony Kennard Friend Of Alec Excellence Fund In 1,015, Temple Foundation Endowed Professorship No.2 758, Temple Foundation Endowed Professorship No.3 711, Temple Foundation Endowed Professorship No.4 941, Morris And Rita Atlas Chair In Advocacy 45, Clark W. Thompson, Jr. Chair In Accounting 1,181, , Charles And Elizabeth Prothro Regents Chair In 2,308, Fulbright And Jaworski Professorship In Law 105, Ben H. And Kitty King Powell Chair In Business And 2,085, Margaret Mckean Love Chair In Nutrition, Cellular And 1,427, Vinson And Elkins Chair In Law 1,377, J. Nalle Gregory Regents Professorship In Geological 756, Clark W. Thompson, Jr. Professorship In Accounting 427, Gustavus And Louise Pfeiffer Professorship In 539, Robert M. Leibrock Friend Of Alec Excellence Fund 30, Mitsubishi Heavy Industries Chair In Japanese Studies 1,143, Lorene Morrow Kelley Endowed Faculty Fellowship Fund 3,710, Lorene Morrow Kelley Excellence Fund 1,572, Mitsubishi Heavy Industries Professorship In Japanese 572, Charles And Elizabeth Prothro Regents Chair In Health 1,110, M. June And J. Virgil Waggoner Regents Chair In 2,224, Cleo H. Key Friend Of Alec Excellence Fund 34, Pricewaterhousecoopers Endowed Faculty Fellowship In 217, Texas Distinguished Faculty Fellowship 220, Nancy Lee And Perry R. Bass Regents Chair In Marine 3,135, Nancy Lee And Perry R. Bass Regents Chair In 5,918, Investment Income Net Increase Investment (Decrease) In Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August31, , , , , , ~ , , , , , , , , , , , ,829, , , , , , , , ,522, , , , , , , ,051, , , , , , , , , , , , , ,232, , ,389, , , , ,158, , ,477, , ,426, , , , , ~, , , , , , ,183, , ,841, , ,627, , , , ,149, , ,302, , , , , , , , ,245, j>. 207, ,125, <0
59 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, Net Position Gift Additions to September 1, 2012 Endowments Albert W. And Alice M. Weeks Fund In Geology 1,320, Tanabe Research Laboratories, U.S.A., Inc Regents 226, Engineering Foundation Endowed Faculty Fellowship In 269, Charles E. And Sarah M. Seay Regents Chair In Finance 1,359, Sarah Meadows Seay Regents Professorship In Business 207, James B. Goodson Professorship In Business 321, H. 0. Head Centennial Professorship In Real Property 20, Judge Benjamin Harrison Powell Professorship In Law 20, Dahr Jamail, Randall Hage Jamail, And Robert Lee 913, Untitled - Jamail Chair In Law 913, Harry Reasoner Regents Chair In Law 912, The Friends Of Joe Jamail Regents Chair In Law 914, Ruth Carter Stevenson Regents Chair In The Art Of 1,701, Faculty Research Program For Latin American Studies 1,024, I. H. Silberberg Endowed Undergraduate Petrophysics 105, The Texas Center For Writers Director'S Fund 10,064, J. J. Jake Pickle Regents Chair In Public Affairs 2,336, J. J. Jake Pickle Regents Chair In Congressional 982, Randal B. Mcdonald Chair In Accounting 1 '164, Welch Foundation Graduate Research Endowment Grant 1,583, The Jesse Villarreal Endowment Fund 64, Lee Hage Jamail Regents Chair In Education 1,896, W. Bryan Trammell, Jr. Teaching Excellence Award 60, Board Of Visitors Graduate Student Endowment Fund 204, Michener Fellowship Program Support Fund 6,931, Hal Box Fellowship In Architecture 974, Fred T. Goetting, Jr. Memorial Endowed Presidential 171, Joe J. King Chair Of Engineering 1,216, Barrow Periodical Fund 447, , Cam Chair I 2,323, Cam Chair Iii 2,757, William Stamps Farish Professorship In Law 62, Glaxo Wellcome Inc. Endowed Professorship In Pharmacy 335, Sonia Wolf Wilson Regents Administrative 296, Ken Mcintyre Professorship For Excellence In School 372, Knight Chair In Journalism 2,798, W. H. Deacon Crain Theatre Production Endowment 125, Patterson-Banister Chair 3,054, Department Of Microbiology Winifred Small Jones 1,020, Harry Huntt Ransom Chair 1,196, Clyde E. Lee Endowed Professorship In Transportation 204, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 46, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions 3, , , , , , Net Position August 31,2013 1,369, , , ,407, , , , , , , , , ,760, ,060, , ,418, ,418, ,016, ,205, ,639, , ,963, , , ,174, ,008, , ,259, , ,412, ,875, , , , , ,896, , ,161, ,056, ,238, ,264.09
60 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Mollie Villeret Davis Professorship In Learning 278, Richard And Ann Berger Heat And Mass Transfer 53, , Jane Weinert Blumberg Chair In English 776, Terry Hemeyer Fund In Communication 46, George And Ronya Kozmetsky Fellowship In lc2 168, John J. Mcketta And HelenS. Mcketta Endowment 993, Ron Wyllys Newsletter Fund 19, Lawrence C. Biedenharn, Jr. Endowment For Excellence 827, Heywood Woody Mcgriff Dance Endowment Fund 70, Thomas 0. Hicks Endowed Chair In Business 1,571, H. Malcolm Macdonald Chair In Constitutional And 800, , Swedish Excellence Endowment 899, Herbert H. Woodson Endowed Excellence Fund 419, Mechanical Engineering Endowed Excellence Fund 150, Walter Prescott Webb Chair In History 3,212, Gilbert Teaching Excellence Award Endowment 17, John Pier Eben Endowment For Business 42, Pat And Shelby Carter Endowment For Educational 147, John Pier Eben Endowment For Education 42, Perry R. Bass Chair In Fisheries And Mariculture 2,236, Brochstein Excellence Fund 31, Ben H. Caudle Endowed Excellence Fund 440, The Josleen And Frances Lockhart Memorial 179, A. Dalton Cross Professorship In Law 22, Judge Solomon Casseb, Jr. Research Professorship In 22, The Lucy And Henry Wilkinson Shakespeare At Winedale 970, David And Mary Winton Green Chair In String 2,224, The Fsx Professorship In Space Applications And 140, Burg Family Professorship In Law 342, Endowment For Chinese Studies 357, Shelby H. Carter, Sr. Endowment For Entrepreneurial 138, Barbara Jordan Chair In Ethics And Political Values 13, Lester J. Reed Professorship In Biochemistry 294, Leonardi F. Kreisle Endowed Presidential Scholarship 88, Jaime N, Delgado Endowed Professorship In Pharmacy 220, M. June And J. Virgil Waggoner Chair In Molecular 2,652, Robert And Ann Pratt Endowed Professorship In 326, , Lynn F. Anderson Endowed Professorship Fund 95, The Rachael Dougherty Vaughan Endowed Excellence Fund 905, Jane Howe Gregory Plan li Program Excellence 243, Joe N. Perrone Endowed Presidential Scholarship 38, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31,2013 9, , , , , , , , , , , ,028, , , , , , , , ,627, , , , , , , , , , , ,404, , , , , , , , , ,314, , , , , , , , , , ,004, , ,302, , , , , , , , , , , , , , , , , , ,746, , , , , , , , , , , ,
61 ()"! tv Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Increase Investment (Decrease) in Fair Income (Realized Net Other Net Position Gift Additions to Investment Value of Gains and Additions/ Net Position September 1, 2012 Endowments Income Investments Losses) Deductions August 31, Max Sherman Chair In State And Local Government 86, , , Wilson M. And Kathryn Fraser Research Professorship 223, , , Dorothy And John Pope Excellence Fund 123, , , Wayne Bell Excellence Fund For Historic Preservation 14, , Linda And David Schele Chair In The Art And Writing 1,269, , , (37.70) ,316, Chair For Western Hemispheric Trade Studies 1,672, , ,730, Mac And Lisa Tichenor Endowment For Excellence 334, , , Joe J. King Chair Of Engineering No.2 1,054, , ,091, The Laura Randall Schweppe Endowed Lecture Series In 129, , , Sws Teaching Excellence Award In Chemical Engineering 81, , , Glenn And Martha Vargas Fund For Gem And Mineral 88, , , Millard B. Arick Memorial Fund In Petroleum Geology 21, , Richard And Shirley Tucker Endowed Scholarship In 306, , , , The Robert A. Welch Chair In Chemistry 3,082, , ,191, The Barbro Osher Pro Suecia Foundation Excellence 147, , , Rom Rhome Endowment For Professional Development In 37, , , Teresa Lozano Long Endowed Chair In Kinesiology And 1 '119, , ,158, Joe R. Long Endowed Chair In Democratic Studies 1,204, , ,247, Burton E. Grossman Excellence Fund In Latin American 853, , , Peter T. Flawn Series In Resource Management And 60, , , Linda Schele Series In Maya And Pre-Columbian Studies 117, , , J. MariON West Chair For Constructive Capitalism 1,041, , ,077, William Howard Beasley Iii Professorship In The 222, , , Gene Edward Mikeska Endowed Chair For Interior Design 1,010, , ,045, John A. And Katherine G. Jackson Exploration 35, , , , William D. Armstrong Music Leadership Endowment 125, , , Jacob And Frances Sanger Mossiker Chair In The 934, , , Gene And June Gillis Excellence Fund In Chemical 1 '184, , ,225, Marlene Nathan Meyerson Photography Fellowship 310, , , William And Bettye Nowlin Chair In Engineering 2,321, , ,403, William H. Cunningham Student Endowment 1,842, , , ,916, Carol And Jeff Heller Engineering Excellence Fund 958, , , Wayne H. And Joan King Holtzman Endowed Graduate 33, , , El Paso Corporation Energy Finance Program Fund 594, , , Mirant Corporation Energy Finance Program Fund 467, , , Mba Excellence Fund For Students And Faculty 1,098, , ,137, Energy Finance Program Fund 1,098, , ,137, Alfred Jr. And Ruby D. Wagner Endowment Fund 130, , , Kay Fortson Chair In European Art 1,093, , '132, George Ann And Amon G. Carter, Jr. Endowment For 63, , , , Patty And James Huffines Endowment 57, , , ,076.83
62 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Gwyn David Media Endowment 76, Dick Rothwell Endowed Chair In Chemical Engineering 2,287, Pre-Columbian Art And Cultures Endowment 1,106, Charles F. Wiebusch Endowed Fund 43, Trisha Wilson Endowed Professorship Fund 126, Henrietta M. King Endowed Excellence Fund For 27, Bob Williams Endowment For Excellence In 74, , Brooke And Frank Aldridge Endowed Faculty Excellence 56, Horizon Pharmacies, Inc Student Professional 20, Silicon Laboratories Endowed Chair In Electrical 2,632, Hampton K. And Margaret Frye Snell Endowed Chair In 2,013, John P. Schneider Excellence Endowment 28, , Reese Endowed Professorship In Engineering 368, S. Griffin Singer Endowed Professorship In Journalism 606, William M. Noble Endowment In Interactive 16, James R. Roach Endowed Fund In American Foreign 272, Gordon T. Lepley lv Endowed Memorial Teaching Award 32, Joe M. Parsley Endowment For Excellence 128, , Jen Duggan Endowed Graduate Fellowship 267, , Bank One Endowed Excellence Fund For Business 309, Alumni And Friends Endowed Fund For Student 43, C. P. Pete Oliver Memorial Endowment For Genetic 26, Robert A. Welch Chair In Science 3,558, Robert L. Moore Chair In Mathematics 1,199, Walter Prescott Webb Special Australian Studies Fund 878, Arthur J. Thaman And Wilhelmina Dore' Thaman Endowed 417, Arthur J. Thaman And Wilhelmina Dore' Thaman Endowed 417, Arthur J. Thaman And Wilhelmina Dore' Thaman Ed owed 417, E. M. Ted Dealey Professorship In Business 445, Joe M. Dealey, Sr., Professorship In Media Studies 449, The Joe And Doris Harlan Memorial Library Fund 121 ' Byron Fullerton Endowment For The Study And 24, Mccall Endowed Excellence Fund 47, Mark And Ellen B. Morrison Endowment 65, , The James H. Parke And Catherine Neal Parke 94, Anne Eastland Spears Endowment 106, Gordon And Mary Hancock Cain Excellence Fund For 3,290, Dolores V. Sands Chair In Nursing Research 822, Herb Kelleher Chair In Entrepreneurship 2,315, Jeff And Gail Kodosky Endowment For Excellence In 6,672, Stephan A. And Shereda James Endowed Faculty 303, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , ,367, , ,145, , , , , , , , , , , , ,724, , ,083, , , , , , , , , , , , , , , , , , , , , , ,683, , ,241 ' , , , , , , , , , , , , , , , , , , (4.44) , , , , , , fJ.15 3,440, , , , ,396, , ,907, (11 10, , w
63 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 (.)1.,.. Net Position Gift Additions to September 1, 2012 Endowments Fletcher Stuckey Pratt Chair In Engineering 2,389, Mike Rivera And Jennifer Elice Ortega President'S 31, John A. And Katherine G. Jackson Endowed Fund In 317,212, J Campbell Murrell Endowed Excellence Fund 254, Robert And Shirley Phillips Endowed Excellence Fund 154, Frederick M. Baron Chair In Law 89, Hudson Matlock Professorial Endowed Excellence Fund 363, , C. Courtland Huber Endowed Teaching Excellence Fund 272, Business Honors Program Excellence Fund In Business 451, , Frank A. Bennack, Jr. Chair In Journalism 1,360, Deloitte And Touche Endowed Chair In Accounting 2,347, , Endowment For The Study Of American Spirituals 985, , Texas Chair Of German Literature And Culture 1,476, Karl Folkers Chair In Interdisciplinary Biomedical 2,049, Karl Folkers Chair In Interdisciplinary Biomedical 1 '162, Warren J. And Viola Mae Raymer Chair 1,860, Goldman, Sachs And Co. Endowed Fund For Academic 212, Endowment For Excellence 29, Hicks, Muse, Tate And Furst Center For Private Equity 5,937, Arthur Andersen Endowed Excellence Fund In Business 114, Warren J. And Viola Mae Raymer Professorship 888, Posco Chair In Korean Studies 1,464, John A. And Katherine G. Jackson Graduate Fellowship 6,024, Red Mccombs School Of Business Endowed Excellence 264, Martha Leipziger-Pearce Endowed Scholarship In Art 111, TheW. Cleigh Nease Professorship In Biblical Greek 324, Iris Howard Regents Professorship In English 700, Frank And Susan Bash Endowed Chair For The Director 1,985, Dean Barbara W. White Excellence Fund In Social Work 75, The Gwyn Shive, Anita Nordan Lindsay And Joe And Cherry 340, William And Gwyn Shive Endowed Professorship 359, Ruth Grundy Library Endowment 11, Frank Den ius Normandy Scholars Endowment 722, , William J. And Shirley J. lhlanfeldt Endowed Faculty 683, , National Instruments Endowed Scholarship For 61, , M. C. Bud And Mary Beth Baird Endowed Chair 1,164, Jewish History, Life, And Culture Series Endowment 142, Bridwell Texas History Series 75, Virginia And Richard Mithoff Endowed Excellence Fund 99, Tom W. White Endowed Excellence Fund In Business 119, Alumni Endowed Excellence Fund In Accounting 589, , Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 83, , ,867, , , , , , , , , , , , , , , , , , ' , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions ,212, , , Net Position August31, ,473, , ,292, , , , , , , ,408, ,433, ,275, ,528, ,121, ,202, ,925, , , ,145, , , ,515, ,235, , , , , ,056, , , , , , , , ,205, , , , , ,876.15
64 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Blossom Flowers Ford Burns Excellence Endowment 330, Greg And Shana Levenson Endowment For Political And 40, Cockrell Consolidated Chair In Engineering 25,025, ,278, Roland K. Blumberg Endowment In Physics 208, Roland K. Blumberg Endowment In Astronomy 208, Robert K. Goldhammer Chair In Carbonate Geology 1 '167, George J. Roessler Memorial Endowment In Chemical 31, Brooke E. Sheldon Endowed Professorship Of Management 135, , Carolyn Frost Keenan And Charlie Gaines Educational 51, Chernoff Family Library Fund For Geophysics And Earth 101, , Arthur Anderson Alumni Centennial Accounting 881, Helen M. Powell Traveling Fellowship 97, Howard And Wendy Berk Endowed Excellence Fund 105, Sarah And Ernest Butler Professorship In Opera 282, Wartsila North America Mesoamerica Center Endowment 140, Cockrell Family Consolidated Departmental Chair In 7,628, Kpmg Endowed Excellence Fund In Accounting 852, , Bob And Betty Agnew Endowed Excellence Fund In 177, Marcile Hollingsworth Endowed Excellence Fund In 32, Ting Sin Go Friends Of Alec Endowed Excellence Fund 75, , Sue Fairbanks Endowment For Excellence In The 43, , American Constructors Endowed Excellence Fund 26, Chris M. Shaughnessy Endowed Excellence Fund In 69, , Center For Learning And Memory Endowed Excellence 25, Susan K. Conner Endowed Excellence Fund In Business 25, George L. Mcgonigle Excellence Fund In Electrical 76, , Dr. Carl E. Adams, Jr. Endowed Excellence Fund For 43, George H. Sawyer Memorial Endowed Excellence Fund In 181, , Rafkin Excellence Fund For The Chair Of Human Ecology 50, James W. Tankard, Jr., Excellence In Graduate 25, Accenture Endowed Excellence Fund 108, Margaret Adams Griffin Excellence Endowment In Human 21, Aaron Cawley Endowed Excellence Fund In Petroleum And 86, Dr. Steven W. Leslie Student Professional Development 44, Gregory Vlastos Archive Travel Fund Endowment 23, Judy And Russ Slayback Fund For Hydrogeologic Field 113, Theriot Family Friends Of Alec Excellence Fund In 52, Osterhus Family Endowed Excellence Fund In Chemical 152, , N. Kemp Maer, Sr. Endowed Excellence Fund In Physics 25, Carol Carley Nelson Excellence Endowment In Human 43, Karen And George Casey Endowment For Excellence In 27, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , , , ,182, , , , , , , , , ,214, , , , , , , , , , , , , , , , , , , , ,896, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,
65 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 (.)1 O"l Net Position Gift Additions to September 1, 2012 Endowments Joe R. And Teresa Lozano Endowed Professorships 1,371, National Instruments Endowment For Excellence In 21, Wagner Field Geology Fund 312, , Endowment For Excellence In Individual Events 51, Sherron Smith Jordan Snead Undergraduate Excellence 27, G. Stacy And Ashley Smith Endowed Excellence Fund In 148, Julia Scarborough Fisher Study Abroad Endowment 84, Louis Waldman Endowed Program Fund For Study Abroad 21, Carol Akkerman Crawford Excellence Endowment In Human 21, Maureen Healy Decherd '73 Teaching Endowment For 996, Maureen Healy Decherd '73 Teaching Endowment For 473, Weller Excellence Fund Endowment 42, William S. Livingston Endowed Chair In Writing 849, James A. Michener Endowed Chair In Writing 846, John A. Kings Memorial Excellence Endowment 492, Rgk Foundation And Kle Foundation Excellence 85, Carolyn And Dick Shell And Kle Foundation Endowment 49, , Ralph T. Hull Endowed Excellence Fund 112, Robert And Diana Ayers Endowed Excellence Fund 98, Amy Johnson Mclaughlin Administrative Chair In Human 857, Stephens Family Endowed Excellence Fund In Petroleum 150, The Cain Foundation Memorial Endowed Excellence Fund 42, Jean Kellner Durkee Excellence Endowment In Human 21, Robert H. Cuyler Endowed Lecture Series 224, Pipkin Field Geology Endowment 32, Marjorie Morales Endowment For Excellence In Teacher 24, Dallas Shakespeare Club Excellence Endowment 25, Radcliffe Killam Field Geology Endowment 22, Josey Family Endowed Excellence Fund In Business 186, Janet Berkman Maxon Excellence Endowment In Human 25, Robert K. Conklin Endowed Excellence Fund In Business 124, , James W. And Ruth B. Pennebaker Social Psychology 90, , Betty Sue Diebel Newton Excellence Endowment In Human 43, E. c. And R. M. Woolfolk Endowment 42, Samantha Sue Sam Scuro Endowment For Excellence 43, Daniel T. Gerron Endowed Excellence Fund For Asian 43, Barbara Wofford Excellence Endowment In Human Ecology 87, Carol B. And W. Edward Nelson Field Camp Experience 87, , Sarah And Ernest Butler School Of Music Endowment 14,918, Larry R. Faulkner Endowment For Excellence In 512, , Sarah And Ernest Butler Professorship In Opera 261, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 48, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , Net Position August 31, ,419, , , , , , , , , ,031, , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,442, , ,503.78
66 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments R. L. And Victoria Nowlin Endowed Excellence Fund In 190, Kle Foundation Endowment For Excellence In Teacher 366, Jennifer Beth Lowry Excellence Endowment In 21, Woody Pace Field Geology Fund 14, Harold Metts Endowment For Shakespeare At Winedale 217, Dr. Jerry And Joan Fineg Student Professional 29, Dina Sherzer Fund For Excellence 28, Gregg And Marilyn Harris Friends Of Alec Endowed 179, , Gary M. And Cynthia z. Weed Endowed Excellence Fund 164, , Sally Sue Davis Klinck And Kle Foundation Endowment 56, Beulah Johnson Wilson Endowment For Excellence In 25, Lyle And Margaret Baker Endowment For Excellence In 85, Stephen Joseph Tripodi Endowed Excellence Fund 28, Joel Sherzer Fund For Excellence 28, , Lawrence E. Gilbert, Jr. Excellence Endowment 531, Michael Reardon Endowed Excellence Fund For Equal 42, Louis M. Pearce, Jr. Endowed Excellence Fund In 95, R Gordon And Louise Appleman Excellence Fund In 30, Excellence Fund For Topics In Sustainable Development 163, Reynolds Family Excellence Endowment For Shakespeare 48, , Marjorie B. Poyner Study Abroad Endowment 23, Friend Of Alec Excellence Fund 1,566, , Rosamond Allen Haertlein And Jeanne Allen Ferrin 99, , The Bill C. Cotner Field Experience Fund 69, Professor David Armstrong Graduate Excellence Fund In 24, William S. Flores Sr. Field Experience Endowment 72, Kathy And Richard Leach Field Experience Endowment 175, , Plains Exploration And Production Company Field 47, Terry And Jan Todd Series On Physical Culture And Sports 103, Richard Schmerbeck And Kle Foundation Endowment For Excellence 59, William Randolph Hearst Faculty Fellowship Endowment 706, Chiang Endowed Excellence Fund For Ewre 33, Caee External Advisory Committee Endowedexcellence Fund 48, , David And Ruth Beer Endowment Forstuden Excellence In Technical Com 55, Edward Cundiff Memorial Excellence Fund in Marketing 117, Cherry & Joe Gray Student Excellence Fund 43, Major Christopher Cooper Endowed Air Force ROTC Excellence Fun 119, Wofford Denius Chair in Entertainment Studies 1,240, Transportation Engineering Endowed Excellence FUnd 41, John Wilson Excellence Fund for the Vertebrate Paleontology Laboratory 74, Jacque Nell & David Scott Holland, Sr. Student Excellence Fund In Geoscie 172, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , (12.67) (58,523.93) 1,580, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,286, , , , , ()1 6, , J
67 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 (.T Paul F. Barnhardt, Jr. Endowed Excellence Fund in Business Sarah & Ernest Butler Professorship in Music Leslie Surginer Endowed Professorship Ellen Clayton Garwood Centennial Professorship in Creative Writing # Terry Norman Forrester & Nancey Hoppess Forrester Dean's Excellence Fu Raymond Merlin Myers Endowment for Excellence in Plan li George & Martha McGonigle Excellence Endowment in Human Ecology Swenumson-Baker Geophysics Excellence Fund Jacob and Frances Mossiker Chair in the Humanities # Jacob and Frances Mossiker Chair in the Humanities # Charles Wilson Chair in Pakistan Studies Canning Endowed Excellence Fund in Civil Engineering W.A. "Tex" Moncrief, Jr. Chair in Computational Engineering and Sciences Net Position Gift Additions to September 1, 2012 Endowments 84, , , , , , , , , ,168, ,168, , , '157, ,379,982, , , , , Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 2, , , , , , , , , , , , ,393, (3,582.57) Net Other Additions/ Deductions 10, , (631,973.00) Net Position August 31, , , , , , , , , ,209, ,209, ,021, , '198, ,426,352, TOTAL INSTRUCTION 3,611 ' RESEARCH Atlantic Richfield Company Centennial Endowed Marilyn F. And Thomas J. Billings Core Preparation David C. Bonner Polymer Laboratory In Chemical Computational Fluid Dynamics Laboratory Conocophillips North American Production Enhanced Oil The Dow Chemical Company Foundation Process Control Dow Chemical Endowment For Computer Process Control Dresser Atlas Well Logging Laboratory Eaton Industries Drilling Engineering Laboratory C. Shults Faulkner Catalyst Research And Development General Motors Foundation Centennial Endowment For Himmelblau Graduate Research Reference Room Billy And Claude Hocott Centennial Distinguished nstitute For Constructive Capitalism Fund Myron George Kuhlman Polymer Processing Laboratory Joe And Charleen Magliolo Laboratory For Polymer Robert N. Miller Drilling Fluids Laboratory Conocophillips Drilling Fluids Properties Laboratory William Shive Biochemical Research Endowment Oryx Energy Company Advanced Petrophysics Laboratory Tenneco Oil Advanced Petrophysics Laboratory Herman J. Wetegrove Graduate Computation Laboratory Texaco Steamflooding Lab Endowment Harlan J. Smith Postdoctoral Fellowship 75, , , , , , , , , , , , , ,627' , , , , , , , , , , , , , , , , , , , , , , , , (3,153.36) 57, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,780.90
68 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Linda Escobar Graduate Research Fund In Tropical 37, Faculty Fellows Program 1,549, Cam Chair In Visualization 1,312, Cam Research Innovation Endowment 7,687, Warren Skaaren Film Research Endowment 57, Geraldine Hill Styles Scholarship Fund 4,144, Harry Lucas Jr. Endowment Fund 711, William A. And Madeline Welder Smith Endowment 90, Lundell Endowment For The Lundell Herbarium 925, Lundell Endowment For Lundellia 463, L. Decker Dawson Fund In Exploration Geophysics 1,334, Will C. Hogg Memorial Fund 120,703, Frances Fowler Wallace Memorial Fund 87, Derossette Thomas Fund For The As a Mitchell Guidance 166, Varner-Bayou Bend Heritage Fund 156, Robert Lurnb Endowment 834, M. June And J. Virgil Waggoner Endowment For 1,676, Betty Lynn Mccormick Endowed Excellence Fund 44, Fred M. Bullard Student Research Fund 65, William And Bettye Nowlin Faculty Research And Travel 379, Endowment For The Institute For American Military 60, Anthony F. Amos Endowment For Support Of The Animal 335, , C. Lee Walton, Jr. Memorial Fund For Mcdonald 73, Fred H. Moore Excellence Fund For Research In 136, W.A. Tex Moncrief, Jr. Chair In Distributed And 2,098, W. A. Tex Moncrief, Jr. Chair In Computational Life 2,191, John Ring La Montagne Memorial Endowment In 940, , Ewre Analytical Instrumentation Center Endowment 391, , Doyle-Carson Excellence Endowment For Alcohol And 25, The Abell Family Fund For Graduate Student Support 71, James H. Paulin Longhorn Life Endowment 114, Rew Family Graduate Research Endowment In Nursing 61, , Ernest L. And Judith W. Lundelius Endowment In 104, , National Initiative For Simulation-Basedengineering And Science End 40,663, Charles E. Lolodzey Civil Engineering Centennial Endowment 601, Pearson Center for Applied Psychometric Research 157, , Dr. James Morris Goforth Endowed Excellence Fund in Biomedical Eng 37, Barbara & Alan Dreeben 40 Acres Scholarship in Business 330, St. David's Excellence Fund for Health Promotion and Disease Prevention 2,938, Port Aransas Rod & Reel Club Fund for Graduate Student Support in Fisher 10, , W. Parker Frisbie Fund for Excellence 49, , Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 1, , , ,607, , , ,361, , , ,974, , , , ,290, , , , , , , , , , , ,384, ,359, , ,559, , , , , , , , , , , , 735, , , , , , , , , , , , , , , , , ,176, , , ,273, , , ,035, , , , , , , , , , , , ,429, , ,172, , , , , , , , , , , ,041, , , (1,574.17) 53, <0
69 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31,2013 en 0 Net Position September 1, 2012 Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) Net Other Additions/ Deductions Net Position August 31, Darrell K. Royal Endowment for Medical Research William Fisher Research Fund Wendi & Brian Kushner Undergraduate Innovation Research Fund Arnold Newman Fellowship in Photography Alma Faye "Abbie" Madden Endowment for Medical Research 150, , , , (83.33) (5,558.44) (36.65) (301.81) (1,207.22) 28, , , , , , , , TOTAL RESEARCH 198,535, ,683, ,086, (3,102.90) 789, ,090, PUBLIC SERVICE Jesse H. Jones Public Conferences Fund Jorge De La Rosa Get Out The Vote Memorial Fund Bill And Alice Wright Endowment For Photography Stanley Burnshaw Lecture Endowment Maxine And Jack Zarrow Endowed Lecture Series For ma Hogg Endowment Don And Elaine Carlton Children'S Wellness Center Lady Bird Johnson Wildflower Center Endowment Texas Union Permanent Art Collection Endowment William And Bettye Nowlin Series Lady Bird Johnson Legacy Endowment In Native Plants, Janey And Dolph Briscoe, Jr. Endowment For Texas Jamal And Rania Daniel Series Endowment Lady Bird Johnson Legacy Endowment For Interiors And Decorative Arts Donald Davis, Jr. Endowed Lectures Ragsdale Endowment for Winedale Preservation McGarr Symposium on Sports and Society Robin & Trey Hancock Center Space Endowment 2,658, , , , , ,651, , ,057, , , , ,375, , ,684, , , , , , , , , , , , , , ,145, , , , , , , , , , , ,751, , , , , ,797, , ,342, , , ,424, ,164, , , , , , , TOTAL PUBLIC SERVICE 60,026, , ,106, , ,155, ACADEMIC SUPPORT A. M. Aikin Regents Chair In Education Leadership Museum Education Endowment Eugene C. Barker Texas History Collection Nettie Lee Benson Library Fund Leo G. Blackstock Memorial Scholarship Fund Bonham-Dieterich Memorial Fund For Memorial Museum Dora Dieterich Bonham Archives Guide Fund Robert E. Boyer Chair In Natural Sciences Bromberg Memorial Fund The Folkert N. Brons Conference Room 2,112, , , , , , , ,722, , , , , , , , , , , , , , ,186, , , , , , , ,823, , ,263.25
70 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Florence Ralston Brooke Fund For Library Books 162, David Bruton, Jr. Regents Chair In Liberal Arts 2,685, J. Alton Burdine Memorial Fund 25, Charles Raymond And Clinton Edward Burklin Endowment 35, Cba Century Club Unrestricted Endowment Fund 1,568, Centennial Chair In Business Education Leadership 3,535, , Effie Marie Cain Regents Chair In Fine Arts 2,540, Caltex Professorship In Australian Studies 753, The Ben H. Caudle Classroom 32, Chemical Engineering Alumni Memorial Conference Room 42, Chemical Engineering Class Of 1943 Undergraduate 123, JoAnne Christian Centennial Professorship In British 594, Community College Leadership Endowment Fund 5.096, Thomas Mabry Cranfill Lectureship In English 87, Walter Cronkite Regents Chair In Communication 1,250, Dean'S Chair For Excellence In Engineering 3,056, L. Sprague De Camp And Catherine Crook De Camp 55, The Dow Chemical Company Foundation Polymer 132, Dresser Engineering Library Endowment Fund 275, Dresser Industries, Inc. Centennial Lectureship 141, Robert M. Duffey, Jr. Endowed Lectureship 104, Thomas F. And Donna P. Edgar Computer Room 37, , Engineering Foundation Library Collection 435, Margaret A. Eppright Professional Development Fund 80, Exhibitions Endowment Fund 418, George H. Fancher, Jr. Study Hall 34, John Henry Faulk Endowment For The Bill Of Rights 271, Kelly Fearing Endowed Scholarship In Art Education 93, RichardT. Fleming University Writings Collection 44, General Libraries Endowed Development Fund 48, The Loraine O'Gorman Gonzalez Creative 51, Graduate School Student/Faculty Excellence Fund 2,225, Graduate School Of Library Science Development Fund 73, , Joseph Lindsey Henderson Textbook Collection 83, Rom Rhome International Professional Development Fund 305, TheW. H. Irons Memorial Lecture Fund In Banking 22, John Jeffers Research Chair In Law 2,350, Jesse H. Jones Faculty Development Fund 4,415, John E. Kasch Classroom Endowment Fund 34, Frank Kell Library Fund 189, Robert P. Kuhlman Endowment 31, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , ,779, , , , , ,623, , , ,667, , , ,634, , , ' , , , , , , , , ,275, , , , ,294, , , ,170, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,303, , , , , , (73,751.80) 242, , , ,433, , ,570, ' , , , (J) 1, , ~
71 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Ol N Net Position Gift Additions to September 1, 2012 Endowments Lebermann Plan li Excellence Endowment Account 318, Sam Jamal Brown And Sharon Brown Professorship In 1,228, Library Memorial Fund- Various Donors 87, Littlefield Fund For Southern History- First 1,261, Richard W. Mckinney Engineering Library Fund 274, Roy J. Mclean Centennial Fellowship In Sports History 643, Marathon Laboratory 87, Oscar And Anne Mauzy Regents Professorship For 611, The Fred H. Moore Teaching Assistants Excellence 71, Cora Maud Oneal Room Endowment Fund 190, The Carl H. Pforzheimer Endowment 2,888, Conocophillips Chemical Engineering Projects 74, The Sylvain J. Pirson Classroom 28, Frederick Byron Plummer Tutorial Room 32, Harry Ransom Memorial Rare Book Fund Harry H. Ransom Teaching Award 119, Venkat Rayer Centennial Room 42, Roland Gammel Roessner Centennial Professorship In 527, Tom Schmidt Memorial Fund For Books 14, Z. T. Scott Family Endowment For The Performing Arts 5,701, A. E. Skinner Chemistry Library Endowment Fund 160, Arthur L. And Ruth Britton Smalley Classroom Bert Kruger Smith Centennial Professorship In Social 285, C. P. Snow Memorial Fund 117, Bp Exploration Classroom Endowment 33, E. W. Steel Memorial Book Fund-Department Of Civil 24, Texas Cowboys Centennial Lectureship 577, Vertebrate Paleontology Laboratory Endowment Fund 431, Visiting Chair In The Fine And Performing Arts 2,921, James Voss-Texas Instruments Regents Professorship In 496, Edith Pye Weeden Fund 16, E. A. Wendlandt Fund 27, Arno P. Dutch Wendler Professional Development Fund 360, F. L. Whitney Memorial Book Fund- Various 120, Clara Pope Willoughby Centennial Fund For Humanities 400, Robert E. Witt Faculty Excellence Fund 1,043, Shelby H. Carter, Jr. And Patricia Carter Regents 632, Phyllis L. Richards Endowed Professorship In Child 348, , Sam Rayburn Library Endowment 4,999, Mary Anderson Abell Marine Science Institute Library 54, James T. Doluisio Regents Chair In Pharmacy 1,131, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 11 ' , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , (165,596.49) Net Position August 31, , ,271, , ,306, , , , , , , ,989, , , , , , , , , ,902, , , , ' , , , , ,029, , , , , , , , , , ,174, , ,170,920.64
72 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Cary And Kenneth Roberts Endowed Fund In Law 659, Harry W. Atwood Collection Endowment Fund 23, Mary Ellen Durrett Student And Faculty Development 30, Nancy Lee And Perry R. Bass Concert Hall 2,166, Ransom Collection Development Endowment For Modern 568, Fleur Cowles Endowment Matching Fund 1,204, Tipro Endowment For The History Of The Texas Oil 371, Rabbi Simha B. Ben-Zakkai Memorial Endowment 31, Marion And Mark Martin Endowed Law Library Fund 329, Dow Chemical Company Endowed Professorship In The Walter And Gina Ducloux Fine Arts Faculty 1,390, Swede And Nelda Hanson Endowed Scholarship In 191, Frances Wasserman Endowment In Memory Of Dr. Harry 81, Henriette F. And Clarence L. Cline Memorial Endowment 145, George M. Hocking Fund For The Collection Of 60, , Endowed Curatorship of European Art 212, Charles And Elizabeth Prothro Endowment In 1,089, Ruth Crawford Staff Excellence Award 35, Filmscript Acquisitions Endowment 555, Alvin And Helene Eicoff Endowed Professorship In 213, India Studies Endowment Excellence Fund 25, Harry Huntt Ransom General Endowment Fund 3,1 08, MartinS. And Evelyn S. Kermacy Collection Endowment 174, John J. Mcketta Challenge Fund Endowment 1,884, , Hobby Family Foundation Endowment 1,398, Thelma Lynn Guion Geology Staff Award 33, Carl And Lily Pforzheimer Curatorial Endowment 1,291, Annie Blake Head Apparel And Accessory Collection 14, Robert L. Folk Excellence Fund In Geological Sciences 140, Winedale Stagecoach Inn Fund Endowment 4,085, Albert And Ethel Herzstein Charitable Foundation Of 728, Erie Stanley Gardner Endowment For Mystery Studies 140, Edmund J. Fleming, Jr. Marine Science Institute 16, John Greene Taylor Endowment For Collection 64, Earl Jennings Educational Psychology Excellence Fund 36, , James C. Paterson Fund For Excellence In The 203, W. N. Patterson Endowed Book Fund 166, , Dorot Foundation Postdoctoral Research Fellowships In 506, John William Potter Endowed Fund For The 131, Endowed Curatorship In Latin American Art 1,298, , Martha L. Bankhead Endowed Book Fund In Nursing 12, Investment Income Net Increase Investment (Decrease) In Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , , , , ,242, , , , ,246, , , , , , , ; , , ,439, , , , , , , , , , , , , ,127, , , , , , , , , , ,217, , , , ,052, , ,447, , , , , ,336, , , , , ,151, , , , , , , , , , , , , , , , , , , ,432, , en w
73 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ Net Position Gift Additions to September 1, 2012 Endowments Karl Schmitt Endowment 18, Richard G. Worthy Endowment For Excellence 48, David Douglas Duncan Endowment For Photojournalism 630, Sibyl RanfranzAnd Kenneth F. Wells Endowed 61, C. L. And Henriette F. Cline Senior Curator Endowment 663, J. Lamar Johnson Endowment For Excellence In 176, David Mark Cohen Memorial Production Endowment In 150, , sabelle Thomason Decherd Endowment For Preservation 87, Nils P. And Maria Mauritz Family Memorial Endowment 179, Lundell Endowment For The Lundell Library 688, James E. And Ruth Ann Boggs Endowment 84, , David J. Fiszel Endowed Excellence Fund 58, Robert M. And Prudie Leibrock Endowed Professorship 590, Jean And Bill Booziotis Endowed Excellence Fund 42, , Ching And Man-U Yew Endowed Fund 110, Robert Charles Witt And Laura Gutierrez- Witt Library 74, , Ann And David Chappell Endowed Scholarship 34, Billy And Rozanne Rosenthal Endowment For Excellence In 2,480, Louann Atkins Temple Women And Culture Series 166, David Nathan Meyerson Endowment For Collecting Modern 631, William H. Tonn Professorial Assistance Fund 113, Topfer Endowment For Performing Arts Production 2,401, A. Keith Brodkin Endowment For American History 30, Weekscorrea Endowed Presidential Scholarship In 60, Performing Arts Center Endowment For Performing 694, John Nance Garner Fund 1,411, Lonnie F. Hollingsworth Student Professional 25, Jack S. Blanton Museum Of Art Director'S Endowment 448, , Ray Marshall Endowment 80, Alex And Dee Massad Endowment Fund 41, Sua nne Davis Roueche Nisod Endowment 979, Art Acquisition Endowment 29, Delta Gamma Foundation Endowed Lecture Fund In Values 142, Burdine Johnson Foundation Education Endowment 370, Student Government Endowed Excellence Fund 125, Susan M. And Steven R. Fay Endowed Faculty Fellowship 109, The Brown Foundation, Inc. Education Endowment 1,162, Teresa Lozano Long Institute Of Latin American 9,182, Oscar And Anne Mauzy Endowment For Educational Policy 31, Joe N. Prothro Endowed Excellence Fund For Business 255, Patricia Puig And Joseph P. Mueller Dean'S Excellence 86, , Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,567, , , , , , , , ,485, , , , , , , , ,460, , , , , , , , , ,013, , , , , , , , , , , , ,203, , ,505, , , , , , ,812.49
74 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments JackS. Blanton Curatorial Endowment 1,242, Pic Wagner Endowed Graduate Fellowship 516, Ralph And Mary John Spence Endowment For Literature 250, Josefina Paredes Endowed Teaching Award 80, , Ruby Mae Jaycox Education Endowment 37, Jean Lang Bobo Endowed Library Fund 12, Kitty King Corbett Powell Endowment For Teacher 1,563, Larry R. Faulkner President'S Endowed Excellence Fund 1,226, Endowed Fund For Shakespeare Residency Programs 146, Fund For Latin American And Caribbean Library 46, H-E-B Endowed Chair in Marine Science 1,168, The Louise Farmer Boyer Chair In Biblical Studies 2,291, The Professor William Shive Excellence Fund For The 2,430, The Ronald Nelson Smith Chair In Classics And Christian 1,273, Make A Mark Endowed Presidential Scholarship 313, , Jack And Allison Jensen President'S Associates 31, William And Bettye Nowlin Endowed Professorship In 371, Mba Class Of '99 Endowed Graduate Fellowship 62, Anne Byrd Nalle Memorial Excellence Endowment In 42, Honors Program Endowment 172, Kenneth M. And Susan T. Jastrow II Chair In Business 2,435, Lee And Joe Jamal! Dean'S Endowment For Excellence In 1,254, Art History Faculty Research And Travel Fund 127, Virginia Welch Sharborough Fund For Natural Sciences 114, Amado M. Pena, Jr. Endowment For Nisod'S Annual 131, Betsy Ancker-Johnson Endowment For Women In 78, Cheng Wu Taiwan Studies Endowment 12, College Of Fine Arts String Quartet Endowment 5,889, John L. And Susie Adams Endowed Excellence Fund 231, Oscar G. Brockett Theatre Production Support 92, Worthington Endowed Professorship For Ecology And 1,000, Alfred And Edwina Maes Schubert Endowed Fund In 30, , America'S Turning Point: Normandy And World War II 129, Texas Rangers Excellence Endowment 28, Keith And Ann Young Endowed Fund For The Curation Of 70, , Pac Fund For The Creation Of New American Art 110, Craig A. And Denise W. Dubow President'S Associates 33, William L. And Lynda L. Transier Endowed Excellence 33, Norma And Clay Leben Endowment For Excellence In Play 173, Mary Ritchie Key Fund For Linguistics Research 26, , Ophelia Arnett Gilmore Endowment 52, Investment Income Net Increase Investment (Decrease) In Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , ,286, , , , , , , , , , , ,618, , ,269, , , , , , ,209, , ,371, , ,515, , ,319, , , , , , , , , , , , , , ,521, , ,298, , , , , , , , , , , ,096, , , , , , ,035, , , , , , , , , , , , , , , , , , m 1, , '1
75 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, l Net Position Gift Additions to September 1, 2012 Endowments Hrhrc Imprint Series Endowment 35, Woodard And Bernstein Endowment 599, Buck Breland Memorial Endowed Graduate Excellence 77, , Eugene And Dora Bonham Memorial Fund In Business 895, Marvin And Ellie Selig Excellence Fund In 511, , Stengi-Wyer Endowment 752, , James W. And Mallory C. Shaddix President'S 29, Haynes Family President'S Associates Endowment 28, Paul W. And Ann G. Pigue Endowed Excellence Fund 113, Mccombs School Of Business Advisory Council Endowed 680, Frank Mcbee Endowed Excellence Fund 427, Lyman And Eva Lee Reese Endowed Excellence Fund 170, , Trudy And Maurice Kennedy President'S Associates 25, Allen F. Jacobson, Jr. Fund For Excellence In 50, , Shakespeare At Winedale Excellence Endowment 68, Gary S. And Susan B. Farmer President'S Associates 30, The Lucius N. Littauer Foundation Judaica Book Fund 41, Emily And Don Jackson Endowment For Excellence In 63, John T. Stuart Iii Endowed Excellence Fund 28, Endowment For Excellence In Educational Programs At Friends Of Alec Chemical Engineering Fund 629, Friends Of Alec Electrical And Computer Engineering 169, , Friends Of Alec Women In Engineering Fund 239, Friends Of Alec Mechanical Engineering Fund 184, Friends Of Alec Civil Engineering Fund 204, Friends Of Alec Aerospace Engineering And Engineering 84, Frank Gerth Iii Teaching Excellence Fund Frank Gerth Iii Graduate Excellence Fund 134, Peter And Claire Buenz Endowed Excellence Fund 56, Fred And Debra Brinkley Student Professional 33, David 0. Nilsson Endowment For Mexican American And 28, Mcshane Endowment For Excellence In Business 169, Vance L. Stickel! Memorial Student Internship Program 402, Milo M. Backus Endowed Fund In Exploration Geophysics 356, Endowed Fund For Photography 104, , Mr. And Mrs. Allen F. Jacobson, Jr. Excellence Fund 235, Joe Weider Physical Culture Fund 636, JohnS. Sessions Endowed Excellence Fund In Business 32, Silverton Endowment Supporting The Edward A. Clark 525, Steinberg/Spencer Family Professorship In Mental 567, J. Wayman Levell Endowed Excellence Fund 120, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 1, , , , , , , , , , , (600.08) , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , (59,430.51) 1, , , , , , , , , , , , , , , , , , , , , , ,312.45
76 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31,2013 Net Position Gift Additions to September 1, 2012 Endowments Randa Ryan/Sheila Rice Academic Services Support 30, William And Margaret Kilgarlin Endowed Excellence 116, Lawrence And Stel Marie Lowman College Of Education 1,172, Mildred Wyatt-Wold Series In Ornithology 128, Charles A. And Alice C. Reeve Endowed Program Fund 84, , Don And Gina Reese President'S Associates Endowment 29, Aggarwal Endowed Scholarship In Indian Studies 56, Paul D. Gottlieb Endowed Lecture Series 48, , Sarah And Ernest Butler Opera Center 1,929, Ann And Leslie Doggett Endowed Excellence Fund In 114, William R. Johnson Endowed Excellence Fund 387, John And Mary Wheeler Endowed Graduate Excellence 126, Craig M. And Pamela S. Greenway President'S 26, Les L. Allison Endowed Excellence Fund In Business 102, Paul And Mary He Distinguished Lecture In China 50, Miriam C. Watson Memorial Excellence Endowment 27, , Roy Olson Professional Endowed Excellence Fund In 111, , Civil Engineering Centennial Endowment 167, , John B. And Lanette H. Kinnaird Endowment For 137, John A. And Katherine G. Jackson Chair In 2,222, Thomas R. And Lynn B. Mcintire President'S Associates 34, Janice And J. Edward Barger President'S Associates 25, Uhy Mann Frankfort Stein And Lipp Advisors Inc. Endowed 147, , Andy And Peggy Greenwalt Endowment For Excellence In 117, George And Irene Baker Scholarship In Community 102, Rayford Wilkins, Jr. Endowed Excellence Fund In 207, Carpenter Family Mba Student Leadership Center 433, Longhorn Endowed Excellence Fund 54, W. Ronald Hudson Endowed Excellence Fund In Civil 45, Barbara Morgan Coleman Endowed Excellence Fund In 71, William Morton Wheeler-Lost Pines Professorship 320, Cynthia And George Mitchell Foundation Education 244, David 0. Nilsson Endowment And Lecture Series For 101, Exxonmobil Employees Endowment For Excellence In 613, , Student Professional Development Endowment 241, , Endowed Excellence Fund In Honor Of C. Aubrey Smith, 95, Alfred E. Buz And Sue Stiles White President'S 22, Jim And Ann Burk Student Professional Endowment 52, The Jim W. Walker Excellence Fund In Plan li 51, The Discovery Fund 26, Hugh Roy Cullen Excellence Fund 2,012, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 1, , , , , ,213, , , , , , , , , , , , ,997, , , , , , , , , n 105, , , , , , , , , , , , ,305, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , J.65 98, , , , , , , Ol 70, ,083, J
77 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, ) 00 Net Position Gift Additions to September 1, 2012 Endowments Mba Alumni Endowed Excellence Fund 431, , Scott Shane Ingraham Endowed Excellence Fund In 214, Patrick David Parker And Tracy Laquey Parker 57, Mba Leave A Legacy Endowed Excellence Fund 72, , Reliant Energy Productivity Center Endowed Excellence 383, Orange Jackets Endowment For Voices Against Violence 16, Paul C. Ragsdale Excellence Fund For Historic 72, , Claiborne Holt Johnson, Jr. Ph.D. Endowment For 109, Ruth And Andrew Suzman Endowed Excellence Fund 24, The Clarke Family Endowed Excellence Fund In 51, Tricia And Gil Besing Endowed Excellence Fund 302, Rosemary Morris Medley Endowment For Excellence In 87, The Andrew W. Mellon Foundation Research Fellowship 1,279, Jean And Bill Booziotis Excellence Fund 26, Rowe Koehl Plan li Student Travel Endowment 50, Mac Churchill Fund For Excellence 23, Betteann Fill And Donald W. Hultgren Endowed 102, Robert C. And Fallon B. Vaughn Commission Of 125 1,021, David 0. Nilsson Excellence Endowment For Shakespeare 36, Benjamin And Dorothy A. Fruchter Endowed Excellence 24, Glickman Endowed Symposium On Contemporary Issues In 24, John B. And Irene W. Goodenough Endowed Research Fund 2,481, , Jess And Betty Jo Hay Endowment 102, Ira And Louise lscoe Endowed Fund In Psychology 49, Alba A. Ortiz And James R. Yates Endowed Excellence 69, , Charles A. And Linda E. Sorber Excellence Endowment 26, , James R. Yates And Alba A. Ortiz Endowed Excellence 80, Robert H. And Agnes K. Perry, Jr. Endowed Excellence 190, Sean Bourgeois Memorial Library Fund 25, , The Glickman Lecture Series In Early Childhood 24, Victor F. Vasicek Endowed Excellence Fund 42, , Frank M. And Dorothy H. Conklin Endowment For Medical 96, , Shahid And Sharon Ullah Excellence Fund In 24, J. Marc Myers Endowed Excellence Fund In Business 102, Harold Billings Fund For Collection Enhancement 44, William H. Cunningham Endowed Excellence Fund In 321, , Frederick Steiner Endowed Excellence Fund In 30, , Pal-- Make A Difference Endowment In The Texas 22, James R. Elliott Iii Endowed Excellence Fund In 97, Manuel J. Justiz Dean'S Fund For Excellence In 146, , Norman Mailer Endowed Fund 239, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 15, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions (25,619.44) 159, (25,418.47) , , Net Position August 31, , , , , , , , , , , , , ,324, , , , , ,057, , , ,528, , , , , , , , , , , , , , , , , , ,182.31
78 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Posiiion Gift Additions to September 1, 2012 Endowments Robert De Niro Endowed Fund 242, Bee Cave Ecology Endowment 18, William Andrew Lang Endowed Excellence Fund In 101, Schusterman Center Excellence Endowment 1,852, , Brenda And Thomas Sandoz Endowment For Excellence In 26, Helen Frances Novosad Zezula Memorial Excellence Fund 48, Bmc Software, Inc. Endowed Excellence Fund In 82, , Frank Gerth Iii Faculty Fellowships 1,791, Stanley Eugene Neely, '41 Endowed Excellence Fund 52, , Archive Of The Indigenous Languages Of Latin America 113, , Professor Tom J. Mabry Endowed Excellence Fund In 37, , Ryan And Company Endowed Excellence Fund In Accounting 178, , Perceval Fellowship In Medieval Romance 278, Susan T. Jastrow Excellence Fund In Human Ecology 1,081, Rosemary And Daniel D. Azbcik Excellence Endowment In 86, Jane Addams Field Education Development Endowment 37, ' Jack Myers Endowment Fund 144, Eric J. Hultberg Student Professional Development 11, Margaret Dunlap Thompson Excellence Endowment In 290, Robert W. Bybee Endowment For Student Field Studies 113, , Audre And Bernard Rapoport Excellence Fund For 880, Mark And Patricia Moores Endowed Excellence Fund 422, Friends Of Student Field Experience Endowment 174, , Robert And Angela Buchholz Endowed Excellence Fund In 82, Frenchy Falik Journalism Award 65, Advanced Micro Devices Amd Chair In Computer 955, Pricewaterhousecoopers Endowed Excellence Fund In 173, , Amon G. Carter Foundation Art Acquisition Fund 87, William W. And Ruth F. Cooper Graduate Student 123, , WilliamS. Tex And Lana Sanor Livingston Library 11, The University OfTexas Press Fine Arts Endowment 249, , Robert And Marcy Duncan Family Endowed Excellence 313, , M. Ward And Sarah Widener Endowed Presidential 42, Charles N. Prothro Texana Series 98, Richard Gideon Pond Ornithology Collection 8, St Century Fund For U.S. Latino Library Materials 9, Climate Studies Library Fund 12, Hydrogeology Library Fund 30, , Nancy Inman Curator Of Photography Endowment 1 '115, Professor Wolfgang F. Michael German Play 87, Linda And Andy Kerner Endowed Scholarship 95, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 8, , , , , , ,918, , , , , , , , ,854, , , , , , , , , , , , , , '119, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , (369,297.67) 32, , '154, , , (J) 3, , CD
79 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, J 0 Net Position Gift Additions to September 1, 2012 Endowments Virginia Maloney Walker Endowed Scholarship 28, Shakespeare At Winedale Neh Challenge Grant Endowment 662, Harry And Love Hardee Endowed Excellencefund In Mechanical Engineerin Ben G. Streetman Dean'S Legacy Endowment 1 '189, Dick Clark Student Travel Fund 30, H. Paul And Decourey Kelley Endowed Fellowship In Psychometrics 49, Mack Brown Distinguished Chair For Leadership In Global Affairs 93, Anonymous Excellence Endowment 778, , Jack And Beverly Randall Dean'S Chair For Excellence In Engineering 1,665, Dean's Endowed Excellence Fund Tony Hilfer Professorship in American and British Literature 316, Richard Chuchla Dean's Discretionary Fund 50, , Dom Rhome Endowment for Staff Recognition 246, Rom Rhome Endowment for Professional Development in Human Ecology 123, Beverly & William O'Hara Endowed Chair in Business 1,700, , Elizabeth Shatto Massey Endowed Chair in Education 1, Ashley & Lance Loeffler Program Endowment Pilar & Jaime Davila UTeach Internship Fund 872, , Quarles Van Ufford UTIG Field Endowment 78, , Ann & C. Douglas Brown Field Experience Endowment 108, Curt & Susan Hodgson President's Associates Endowment 22, , John Giddens Endowment 393, Compton Field Experience Endowment 66, , Clinch Field Experience Endowment 66, Folger Leadership Chair in Petroleum and Geosystern's Engineering 1,073, , Geosysterns Fund 45, , Jacob's Family Endowment for Excellence in Accounting 84, , Burl & Lorene Rogers Chair in Human Health 1,464, Yates Memorial Endowment- Petroleum Engineering 749, Joe Jamail Endowment for Excellence in Advising 2,180, , Lee Hage Jamail Endowed Excellence Fund in Nursing 2,186, , Myrtle & George Isensee Field Experience Endowment McQueen Field Experience Endowment 106, William Monroe & Elan a Eastham Kerr President's Associates Endowment 16, , Daniel & Susan Allen President's Associates Endowment 29, Sarah & Allen Parks Endowed Excellence Fund in Chemical Engineering 27, Brandon Schantz Memorial Endowment 76, , Environmental Science Institute Endowment Fund for Excellence 58, , Mary Long Endowment for Excellence in Teacher Training 27, School of Architecture Advisory Council Endowed Excellence Fund 90, , Geoforce Texas Fund 60, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) , , , , , , (73.66) , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , , Net Position August 31, , , , ,231, , , , , ,724, , , , , , ,171, ,812, , '1 02, , , , , , , ,211, , , ,515, , ,756, ,762, , , , , , , , , ,053.52
80 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Jackson Undergraduate Scholars Program 455, Mantovani Family Advertising Endowment 38, , Est a van Deleon Endowed Excellence Fund for Equal Opportunity 54, Gensler Exhibitions Endowment 35, Texas German Endowment 56, , Claire Swenson Kolodzey Excellence Endowment 489, Charles E. Kolodzey Dean's Excellence Endowment in Engineering 400, Potter Rose Professorship in Urban Planning 529, Joe & Teresa Lozano Long Endowed Faculty Fellows Fund 603, Jody Conradt Endowed Excellence Fund 41 ' , Natural Sciences Council Endowment 28, Francisco Paco Aromi-Noe Memorial Fellowship in Sustainable Design 60, Darwin Family Geoforce Texas Fund 91, , Joe R. And Teresa Lozano Long Chair In Piano 1 '145, Sherzer Excellence Endowment-Archive of Indigenous Lang Of Latin A mer 45, Excellence Endowment For Kerala Studies 28, Strawbridge Endowed Excellence Fund In Chemical Engineering 34, College Of Natural Sciences Endowment For Excellence 1,103, Raquel Elizondo Staff Excellence Fund 30, Margaret Love Gaither Endowed Excellence Fund 28, Robert Reed Endowed Excellence Fund for Structural Engineering 68, , Centennial Commission Prof in Liberal Arts #2 825, Centennial Commission Prof in Liberal Arts #3 825, Centennial Commission Prof in Liberal Arts #4 825, University of Texas Libraries Advisory Council Book Fund 32, , Pearson Endowed Professorship in Psychometrics 322, Pearson Endowed Faculty Fellowship in Psychometrics 159, Cale McDowell Award for Innovation in Undergrad Studies 27, Curtis & Carol Kayem Endowment for the Visual Arts 339, Journeyman Construction Faculty Excellence Fund in Architecture 107, Wagner Excellence 104, John Kipp Chair in Corporate and Business Law 1,081, Northwind Exploration Field Experience Endowment 30, , Foyt Family Endowment for Student Affairs 108, Fowler End Excellence Fund in Arch & Environmental Engineering 52, BBA Alumni Endowed Excellence Fund 152, , Carol & Jerry Pitts field Experience fund 182, , Susan Mayer Endowment in Art Education 32, Herman & Joan Suit Professorship in Astrophysics 181, Jeff Byers Memorial Graduate Award in Chemical Engineering 33, Nathan Snyder Memorial Fund 17, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , ' , , , , , , , , , , , , , , , , , , , , , , , , , , '185, , , , , , , , ,141, , , , , , , , , , , , , , , , , , , , , , , , , , , '119, , , , , , , , (7.44) 186, , , , , , , , ' , J ~ ,624.67
81 ---1 N Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Increase Investment (Decrease) in Fair Income (Realized Net Other Net Position Gift Additions to Investment Value of Gains and Additions/ Net Position September 1, 2012 Endowments Income Investments Losses) Deductions August 31, Theodore Strauss Student Award for Exemplary University Service 20, , , Sparks Family Endowment in Petroleum Engineering 49, , , , Texas Men's Lacrosse Endowment 37, , , Visual Arts Center Endowment 184, , , (996.83) 252, J.R. Zamora Family Excellence Fund in Engineering & Fine Arts 35, " 1, , , Shockley & KLE Found End for Exc in Teacher Training 53, , , Dean Jack Otis Endowed Lecture Series 57, , , Welchans Library Fund 11, , Kasman Family Lectures in Eastern European Jewish Life & Culture 57, , , , W. Ralph Canada Jr. Endowment for Horns Helping Horns 64, , "12 67, Frank Spindler Endowment for the lnst of Latin American Studies 274, , , (15.22) , Edward Hyman Endowed Chair in Engineering 1,082, , ,120, Dr. and Mrs. Edward Contreras Excellence in Health Professions 26, , Steve & Susan West Visiting New Zealand Scholarship in US History 61, , , ,431, Craig & Sally Clayton Endowed Excellence Fund 99, , ,534, Shirlee Dodge Theatre and Dance Endowment 15, , , College of Communcation Innovation Fund 1,347, , , ,671, Intramural Endowment 29, , , Thomas Fallon Endowed Excellence Fund in Engineering Innovation 62, , , Ann Callaway Brown Endowment Fund for the UT String Project 13, , ,23 18, Manuel Justiz Endowed Professorship in Math, Science and Technology 1,221, , , , ,414, Shivers Cancer Foundation Endowed Excellence Fund in Oncology Nursing 53, , , Keys and Joan Curry Endowed Excellence Fund in Mechanical Engineering 347, , , Keys and Joan Curry Endowed Excellence Fund in Engineering 347, , , McCombs Social Enterprise Fund 126, , , , John Charles Sisson Memorial Lecture 52, , , , John & Jane Barnhill President's Associates Endowment 24, , Charles & Shannon Holley Endowed Excellence Fund in Business 105, , , , , The Allen Family Endowment for Ecellence in Teacher Training 15, , , Mac Churchill Endowed Excellence Fund in Business 60, , , , David 0. Nilsson Endowed Scholarship in Fine Arts 41, , , , Meg and Fred Nallen Endowed Excellence Fund in Business 66, , , , , Milton T. Smith Memorial Director's Excellence Fund Endowment 76, , , Thomas S. Smith Excellence Fund in Entrepreneurship 50, , , , , James Vick Academic Bridge Endowment 31, , , Rosenberg Endowed Excellence Fund in Business and Law 201, , , , , Bowman Excellence Fund in Grad Students in the Dept of History 85, , , (498.52) 97, Charline McCombs 40 Acres Scholarship in Business 541, , , Christy Gaston Bass President's Associates Endowment 15, , , Rosa and Thomas Layman Field Experience Fund 52, , , (88.82) , Janet Riha Neissa and Jimmy Neissa Endowed Professorship in Business 509, , ,158.24
82 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Increase Investment (Decrease) in Fair Income (Realized Net Other Net Position Gift Additions to Investment Value of Gains and Additions/ Net Position September 1, 2012 Endowments Income Investments Losses) Deductions August 31, Ernest Walker Memorial Endowed Excellence Fund in Finance 40, , , , , Zaragoza Ramirez Memorial Excellence Fund 1,030, , ,066, Zaragoza Ramirez Memorial Excellence Fund 39, , , , James and Lauree Moffett Endowment for Excellence in Teacher Training 221, , , (6,247.67) , Thomas Staley Endowment for Excellence in the Humanities 828, , , ,161, Endowment for the Sports Integrated Communication/Media Program 210, , , (6,369.39) , Madison Charitable Foundation, Inc. 40 Acres Scholarship in Business 209, , , , Carl & Jeanne Schulze President's Associates Endowment 1.7, , , Howard & Wendy Berk President's Excellence Fund Endowment 100, , , , Wm. Arlyn Kloesel Endowment for Excellence in Pharmacy 137, , , (128.89) 197, , Robert Schmidt Performance Design Endowment 51, , , , Greg Bailes Endowed Excellence Fund in Accounting 50, , , , , Kelly Thompson Family Endowed Excellence Fund in Business 40, , , , Elaine & Timothy Day Endowed Excellence Fund in Business 39, , , , Criaco Family Endowed Excellence Fund 23, , The Daily Texas Excellence Endowment 21, , , George & Susan Rodenko President's Associates Endowment 14, , , Mark & Jennifer Alford President's Associates Endowment 9, , , John & Diana Null President's Associates Endowment 9, , , Cami & John Goff Endowed Excellence Fund 396, , , , , John E. Watso!) Field Experience Endowment 29, , , , Moton Crockett, Jr. & Martha Crockett Endowment for Big Bertha 96, , , Rob Jones Endowed Excellence Fund in Finance 99, , , Laura L'Esperance Study Abroad Program Endowment 17, , , Ingrid & Manfred Fink Exchange Student Endowment in Physics 29, , , , William Guy, Jr. Excellence Endowment in Mathematics 31, , , , J. Chris & Laura Jones President's Associates Endowment 9, , , Hinich Excellence Fund for Grad Students in the Dept of Government 28, , , Lynn Brill Education and Outreach Endowment 70, , , Emily Summers Excellence Fund for the History of Interior Design 10, , , Bill Stanley Endowed Leadership Chair in Chemical Engineering 1,959, , ,028, Paul Barbara Endowment for Student Excellence in Nanoscience 46, , , , Student Activity Center Program Endowment 120, , , , The Plant Research lnsti.tute Endowment 9, , Richard Lagow Excellence Fund in Inorganic Chemistry 73, , , , Catherine and E. R. Giesinger Endowed Accounting Excellence Fund 45, , , , , Susie & John Adams Endowed Professorship in Business 721, , , (581.28) , Israel Studies Fund 1,963, , ,032, Leah & Mike Hale Endowed Fund for Excellence in the Arts 9, , , Martha & Thomas Melody Endowed Excellence Fund in Business 19, , , , Lawrence Speckpagesoutherlandpage Graduate Fellowship in Architecture 10, , , j w
83 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ Net Position Gift Additions to September 1, 2012 Endowments Scott & Ally son Tinker Bureau of Economic Geology Publisher of the Year A 24, Wender Endowed Excellence Fund in the Business Honors Program 137, , Ray-Pharr Excellence Fund 217, Howard Miller Excellence Endowment for the Graduate Student Support 51, , Stan Richards Endowed Prof for Ethics in Advertising and Publishing 471, Jackson Endowed Fund for Grad School of Library & lnf Sciences 74, , Tom and Charlene Marsh Conservation Endowment for Landmarks 48, Foundation for Religious Studies in Texas Excellence Fund 116, New Works in Theatre and Dance Endowment 19, , Shawn and Kara Wells Endowment for Horns Helping Horns 5, , Cheryl Gunter Assistance Fund for the Speech and Hearing Center 10, , Mark & Linda Evans President's Associates Endowment 14, , Weidner Endowed Presidential Fellowship in Chemical Engineering 43, , Gale Family Foundation Professorship in North American Jewish Life 151, , Gale Family Foundation Professorship in Jewish Arts and Culture 151, , Gale Family Foundation Annual Lectureship in Jewish Studies 247, , Paul Ray/Twine Time Fund for KUT Capital Equipment and Improvements 25, Rankin Endowment for McDonald Observatory for UTeach Workshops 84, , Rob Cullum & Charlyn Bracken Holmes President's Associates Endowment 50, , Walt & Laura Dobbs President's Associates Endowment 6, , Lee & Joseph Jamail Chair in African American Studies 979, David Stevens Endowed Excellence Fund in Chemical Engineering 9, , Chair in Latin American Art History and Criticism 979, Melissa & Kent Ferguson Endowed Excellence Fund in Real Estate 19, , W. Paul Dunn Memorial Endowed Excellence Fund in Engineering 32, , Denise & Kevin Poynter Endowed Excellence Fund in Real Estate 101, Bill & Alice Wright Endowment for Education and Outreach 24, Robert & Diana Ayers Endowed Excellence Fund in Chemical Engineering 69, , Arthur Allert Endowed Excellence Fund in Business 35, , Excellence Fund for Technology and Development in Latin America 531, , Ralph & Reba Ferrell Endowed Excellence Fund in Chemical Engineering 25, David Kelley Endowed Excellence Fund in Real Estate 10, , Jeff & Gail Kodosky Endowed Chair in Physics 510, , Mary Ann Rankin Endowment for Excellence in Teacher Training 50, , Dr. Michael & Carrie Crowley & Dr. Jason & Kasey Graduate Fellowship 30, , Center for Latin American Visual Studies Endowment 1,021, Brian L. Harlan Memorial Endowment 74, , Batterton Family Fund for Graduate Student Support 20, , ris Apfel Endowment for the Historical Textiles and Apparel Collection 34, Morris Beachy Choral Fellowship 30, , Cain Foundation for Medical Education, Research & Programs 1,008, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , ( 49,999.58) 75, , , , , , , , , , (3,863.44) 61 ' , , , , , ' , , , , , , , ,013, , , ,013, , , , , , , , , , , , , , , , , , , ,060, , , ' , , ,057, , , , , , ' , , ,044,022.27
84 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Sylvie & Gary Crum Forty Acres Scholarship in Business 308, College of Natural Sciences Undergraduate Innovation Research Fund 52, Dr. John Longenecker Grad Research Endowment- Dept of Nutritional Scie 26, , Starley Family Endowed Excellence Fund in Real Estate 25, William & Sylvia Zale Endowed Graduate Fellowship 17, , John T. MacGuire Professorship in Mechanical Engineering 534, Governor Ann W. Richards Chair for the Texas Program in Sports and Medi 1,021, Dean Barbara White Fund for Excellence in Social Work Education 20, Indigenous Languages of Latin America Excellence Fund 49, Steven Anderson President's Associates Endowment 5, , Elizabeth Gleeson Professorship in Physics 304, Jere Thompson Endowed Dean's Excellence Fund 173, , Ira & Muriel Maxie Endowment 10, , Mary Beth Bigger Staff Excellence Endowment 41, , Angelo Miele Endowment 38, , Cynthia & Steve Ford Endowed Excellence Fund in Real Estate 19, , Lionstone Group Endowed Excellence Fund in Real Estate 23, Claire & Peter Buenz Endowed Excellence Fund in Chemical Engineering 104, , Kenneth & Theresa Williams Faculty Excellence Endowment 50, , Eleanor Picard Excellence Award 34, Oscar & Lenyth Brockett Professorship in Theatre History 61, , Diane & Samuel Bodman Energy Institute Endowment 99, , Joshu Brown Endowed Excellence Fund in Real Estate 10, Raymond James Energy Group Excellence Fund in Energy Innovation 118, , Sandy & Keith Oden Endowed Excellence Fund in Real Estate 49, , Thomas & Terry Smith Faculty Fellowship in Business 30, , Arnold Chaplik Professorship in Israel and Diaspora Studies 99, , Blake Alexander Architectural Library Endowment 938, R. Scott & Melissa Dennis Endowed Excellence Fund in Real Estate 9, , John Gates Endowed Excellence Fund in Real Estate 9, , Jonathan & Laurie Goldman Endowed Excellence Fund in Business 49, Joann & Gaylord Jentz Endowment for Student Engagement 5, , Stuart W. Stedman Excellence Fund in History 405, , Sharon & Peter Mear President's Associates Endowment 10, , The Daily Texan Excellence in Reporting Endowment 24, , USAA Real Estate Company Endowed Excellence Fund in Real Estate 49, Julian Garrett Research Travel Grant 10, Kent Butler Memorial Excellence Fund in Community & Regional Planning 47, , Nebeker-Gillaspy Endowed Excellence Fund in Chemical Engineering 10, , Texas 4000 Endowed Excellence Fund for Cancer Research in Biomedical 41, , James Ayres Excellence Fund in Shakespeare at Winedale 5, , Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , ,057, (0.03) (20,386.90) 1, , , , , , , , , , , , , , (23.08) , , , , , , , , , (5,141.55) 30, , , , , (120.72) 9, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , J ,
85 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August31, ! OJ Net Position Gift Additions to September 1, 2012 Endowments Dudley & Judy White Oldham President's Associates Endowment 5, , David & Nancy Lubke Temple Graduate Fellowship for Nursing 10, , Simons CHair in Mathematics & Electrical & Computer Engineering 3,061, Clarke Burnham Memorial Excellence Endowment 27, , Richard Mattingly Endowed Book Fund 10, , Tod & Tracy Hammond President's Associates Endowment 25, Charles & Patircia Metcalf Endowed Excellence Fund in Engineering 51, Mimi & Chad Stephens Excellence Endowment Fund 10, , John Brumley Endowed Excellence Fund 1,024, , Elias Sellards Writer in Residence Fund 11, , Undergraduate Real Estate Program Endowed Excellence 57, , Halsey-Leathers Endowed Excellence Fund for the College of Liberal Arts 3,927, , Jessica Fertitta Excellence Fund for Student Advocacy & Civic Engagement 10, , Joe & Mavis Griffith Endowed Excellence Fund in Real Estate 10, , Scott Petty Marine Geology & Geophysics Fund 10, , Pharmacy Administration Graduate Student Endowment 38, , W. James & Patsy McAnelly President's Associates Endowment 5, , ulian Read Excellence fund in Public Relations 149, , Leipziger Travel Fellowship Fund 145, Mollie Steves Zachry Texas Arboretum Endowment 306, , Mary Anne & Bill Dingus Climate and Environmental Science Excellence Fu 30, , Gregory Family President's Associates Endowment 5, , Ray Nixon Endowed Award for Excellence in Finance 25, Lillian Richardson Endowed Excellence Fund in Biomedical Engineering 17, , Doug Forbes Fund 39, , Fred Todd Southern Literature Endowment Fund 22, , Shahid & Sharon Ullah Endowed Chair in Petroleum & Geosystems Engine 1,000, ,000, Kerrnie & David Sloan Endowment for the UT String Project 10, , Salam Fayyad Excellence Fund for Economics 50, Layne & Alex De Alvarez Liberal Arts Honors Fund 5, , Carol & James Farnsworth Endowment for Students In Recovery 20, , Paul Woodruff Endowment for Excellence in Undergraduate Studies 96, , Finance Ph.D. Graduates Excellence Fund in Finance 21, , Susi & Michael Looney Field Experience Endowment 20, Tany Norwood Staff Appreciation Award Endowment 9, , Jastrow-Thomas Endowment for Excellence in the Program in Dietetics 50, Dorothy Maierhofer Scherrill Miller Excellence Endowment in Human Ecolo 35, Scott Shane Ingraham Endowed Excellence Fund in Real Estate 20, Welch Regents Chair in Chemistry Joe & Teresa Lozano Long Chair in Cello Audre & Bernard Rapoport Centennial Chair in Economics and Public Affair Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) , , , , , , , , , , , , , , , (25.75) , , , , , Net Other Additions/ Deductions , (10,715.26) , , , (10, ) (500.00) 37, , ,030, ,000, ,324, Net Position August 31, , , ,169, , , , , , ,236, , , ,460, , , , , , , , , , , , , , , ,034, , , , , , , , , , , , ,104, ,023, ,356,953.38
86 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Scot & Melissa I son Endowed Excellence Fund 5, Organic Chemistry Division Distinguished Alumni Lecture Chad & Lynn Buxton President's Associates Endowment 10, Nicholas Jerrara President's Endowed Excellence Fund 100, Sanger Learning Assistance Fund 70, Norma & Clay Leben Professorship in Child & Family Behavioral Health 31 ' UT in NYC Excellence Endowment 11, Heritage Title Company Endowed Excellence Fund in Real Estate 55, Projects for Under-Served Communities Excellence Fund 25, Martin Bronstein Endowed Excellence Fund in Real Estate 20, Mary Gearing Endowment 53, Dawn & Greg Crouch Endowment for Students in Recovery 200, Brian Jennings Memorial Endowed Chair in Petroleum & Geosystems Engi 500, Sarah Woolrich Endowed Book Fund Roger Stoneburner Family Innovation Fund 500, Judith Craig, Ph.D. Excellence Fund for Mental Health Research 40, Linda & Scott Burdine President's Associates Endowment 25, Donna & Steve Hicks President's Associates Endowment Barbie & Gary Coleman Professorship I Education Guy & Carolyn Matthews Presisdent's Associates Endowment 25, Joseph Malina, Jr. Legacy Endowed Excellence Fund in Civil, Arch & Env E 2, Thomas Runge, M.D. Endowed Presidential Fellowship in Biomedical Engin 100, Cathy & Ed Frank President's Associates Endowment Tony & Lillian Dona Endowed Excellence Fund in Real Estate 40, HFF Endowed Excellence Fund in Real Estate 52, Hunt Realty Investment, Inc Endowed Excellence Fund in Real Estate 50, Steve LeBlanc Endowed Excellence Fund in Real Estate 50, Stratus Properties Endowed Excellence Fund in Real Estate 10, Jeffrey & Ann Swope Endowed Excellence Fund in Real Estate 20, Transwestern Endowed Excellence Fund in Real Estate 20, Merryman/Revell Excellence Endowment 10, David & Alicia Martineau Environmental Science Institute Endowment Fund 5, Jennifer & Jon Mosie Endowed Excellence Fund in Law Gottesman Excellence Fudn for Entrepreneurship 4, Nicolas Cocavessis Legacy Endowed Excellence Fund in Engineering 50, Charles & Patricia Mecalf Legacy Endowed Excellence Fund in Engineering 25, Ann Hartness Fund for Library Materials on Brazil 20, Aubrey and Elsie Fariss Professorship in Accounting 500, Mary Braunagei-Brown Excellence Fund for Young Women's Leadership 62, Lisa & Sandy Gottesman Endowed Excellence Fund in Real Estate Lisa & Sandy Gottesman President's Excellence Fund Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , (648.27) 54, , , , , , , , , , , , , (15,000.00) 40, (13.89) 24, , , , , (279.03) 499, (10.05) 10, , (277.84) 499, (88.14) 15, , (13.89) 24, (13.89) 25, , (166.66) 300, , (13.89) 24, (40.97) 32, , (13.89) 100, (13.89) 25, , (131.47) 10, , (673.07) 53, , (27.78) 49, (673.07) , (5.54) 9, (269.19) 21, , (269.19) 21, , (63.17) 9, (3.52) , (301.81) 25, , (348.49) 100, , (603.61) 49, (301.81) 24, (241.44) 19, (6,035.98) 493, (417.08) 61, (859.39) 250, , (1,019.34) 100, ,
87 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, J 00 Net Increase Investment (Decrease) in Fair Income (Realized Net Other Net Position Gift Additions to Investment Value of Gains and Additions/ Net Position September 1, 2012 Endowments Income Investments Losses) Deductions August 31, Dr. Don Paul Endowed Excellence Fund in Chemical Engineering 30, (362.17) 29, Thomas Whitener, Jr. Undergrad Energy Management Program Excellence 10, (120.72) 9, Pam & Rom Welborn Environmental Science lnsitute Endowment Fund 10, (120.72) 9, Barbara Hall Chamberlain Endowed Graduate Fellowship 50, (120.72) 10, , Billy Carr Distinguished Teaching Fellowship (877.01) 125, , Day Family Excellence Endowment (60.36) 5, , Wofford Denius Endowment in Gaming Design 500, (6,035.98) 493, William Smith, Jr. Grasp Award (257.69) 21, , Beuerlein Endowed Excellence Fund in Real Estate 10, (120.72) 9, Byrne Endowed Excellence Fund in Real Estate 25, (301.81) 24, Endeavor Real Estate Grop Endowed Excellence Fund in Real Estat 12, (120.72) 11, Floyd Undergraduate Energy Management Program Excellence Fund 50, (603.61) 49, Polish Studies Endowment at the University oftexas 43, (249.45) 7, , Thomas Toomey Endowed Excellence Fund in Real Estate 20, (241.44) 19,758, David Barbour Endowed Scholarship in Business 18, (218.82) (46.43) 17, Carter Undergraduate Energy Management Program Excellence Fund 10, , Jim Nolen Award for Excellence in Graduate Teaching 28, , sabella Cunningham Excellence Fund in Advertising 56, (1,323.44) 109, , Hickok Family Endowed Excellence Fund in Real Estate 20, , Bold rick Undergraduate Energy Management Program Excellence Fund 5, , Murray McCabe Endowed Excellence Fund in Real Estate 10, , James Whittenburg Walker Memorial Endowed Scholarship in Bus Honors 11, , Janie & Gappy McGarr President's Associates Endowment 25, , Writer-In-Residence 25, , , Larry Carver Endowment inthe Liberal Arts Honors Program 20, , Nikola Damianov Memorial Excellence Fund 50, , Gondwanaland-A-Job Career Services Fund 25, , Rapid Response Endowed Fund 100, , Chet Flippo Journalism Scholarship 24, (57.51) 24, BHP Parents Endowed Excellence Fund in the Business Honors Program 8, , Jean and Bill Booziotis Endowed Annual Lecture in Architecture 6, , Malkin Family Endowed Excellence Fund 10, , Tseng Brothers Endowed Excellence Fund in Chemical Engineering 9, , Larry and Carole Lake Endowed Excellence Fund 250, , Nick Woodward Memorial Endowed Excellence Fund 5, , Ragen and Rachel Stienke Excellence Fund in Economics 5, (14.92) 5, Thomas and Mary Kay Hunt Endowed Excellence in the Business Honors P 10, (203.39) 9, Lisa and Sandy Gottesman Excellence Fund 100, , TOTAL ACADEMIC SUPPORT 255,255, ,918, ,014, (12,494.20) 8,339,15~ ,515,805.81
88 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position September 1, 2012 Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, 2013 STUDENT SERVICES Jesse H. Jones Job Placement And Counseling Fund 806, Medina Oliver Loan Fund 145, Science In Society Lecture Series Endowment 27, Texas Cowboys Endowment For U T Students 33, Sheila Rice Challenge To Excellence Lecture Series 60, Thomas And Ray Burke Student Job Program 420, Martin B. Lagoe Student Research Fund For 73, Tami J. Pilat-Matias Graduate Student Travel Fund 19, Helen L. Erickson, Phd, Rn, Faan Lecture Series In 19, Wilsonart Endowed Lecture Series in Interior Design 111, Virgil E. And Mildred L. Barnes Distinguished Lecture 66, Dr. Walter J. Burdette Distinguished Lecture Series 62, Anne G. Broussard Book Fund In Women'S Athletics 15, BrightmanNork Endowed Lecture Series In Interior 72, Parents' Association Student Services Endowment Fund 473, , Frito-Lay Student Leadership Center Endowed 177, Ron J. Gieser Student Professional Development 33, Mel Oakes Endowed Undergraduate Lecture Series 112, Mary Alice Davis Distinguished Lecture Series 148, George Kinsolving Endowed Memorial Student Services 26, Lee Bagan Endowment 42, , TOTAL STUDENT SERVICES 2,948, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,069, INSTITUTIONAL SUPPORT Brackenridge Track, Original Endowment Remainder 100,997, Petroleum Engineering Alumni Room Endowment 128, The L. H. Cullum Fund 188, Fine Arts Advisory Council Endowment For Excellence 29, Donald D. Harrington Fellows Program 36,679, Virginia Welch Sharborough Fund For Liberal Arts 114, The J. V. And H. A. Stiles Foundation 196, The Amanda Stoltzfus Memorial Trust 15, Nancy Lee And Perry R. Bass President'S Excellence 1,095, Mary And Ben Anderson Endowment For Graduate Studies 94, Shrader Memorial 12, Roger And Ann Worthington Essay Prize 176, Ellen Clarke Temple Excellence Fund In The History Of 149, , ,048, , , , , , , ,764, , ,022, , , , , , , ,133, , , , , , , , co
89 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 co 0 Net Position Gift Additions to September 1, 2012 Endowments Joe And Bettie Branson Ward Endowed Excellence Fund 44, Jacqueline Barnitz Graduate Endowment In Art History 49, H. Markley Crosswell, Jr. And Elisabeth Holcombe 313, Ron And Phyllis Steinhart Endowed President'S Fund 153, The Ben Streetman Prize 42, Beeman N. Phillips Endowment 62, S. Griffin Singer Student Support Endowment 133, Vincent R. And Jane D. Dinino Chair Fund For Director 666, Weldon H. And Mary Smith Endowed President'S Fund For 102, Robert C. And Carol K. Hewell Fund For Excellence 30, Tom Ward Endowment Fund 131, , Todd And Janie Mason President'S Associates Endowment 27, Ray G. Torgerson Memorial President'S Associates 32, Lois Ford La Bauve Endowment 129, Ernest W. Walker Outstanding Finance Student Award 40, Janey And Dolph Briscoe President'S Associates 31, Lee And Joe Jamail Presidential Endowment For 1,254, Joseph G. And Carol A. Havemann Lynch President'S 145, , Mr. And Mrs. Rene' Garza President'S Associates 35, Joseph Patrick Brannen Graduate Excellence Fund In 127, Frances B. Vick And Ross W. Vick, Jr. President'S 31, Lillian C. Ho Memorial Endowment 235, , James M. Neissa And Janet K. Neissa President'S Robert And Diana Ayers President'S Associates 51, J. Michael Quinn Scholarship And Student Support 55, Mr. And Mrs. Bradley G. Englert President'S 60, , Mr. And Mrs. Stephen D. Susman President'S Associates 26, Blake And Tyler Battaglia President'S Associates 26, Sara Martinez Tucker Endowment For Excellence In 52, Mr. And Mrs. John L. Adams President'S Associates 25, Cary And Kenneth Roberts President'S Associates 28, Endowment For Graduate Excellence In Plant Biology 44, Marla Rupp Ray President'S Associates Endowment 19, Tim And Mary Doyle President'S Associates Endowment 29, Mr. And Mrs. Shea Morenz President'S Associates 21, , David 0. Nilsson Solo Pianist Award 100, Grants For Active Student Participants Grasp 39, Thomas C. Mays Iii President'S Associates Endowment 23, William T. Speller President'S Associates Endowment 35, , Friends Of Alec Petroleum And Geosystems Engineering 166, , Carolyn And Karl Rathjen President'S Associates 24, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 1, , , , , , , , , , , ' , , , , , , , ' , , , , , , , , , , , , , Net Other Additions/ Deductions Net Position August 31, , , , , , , , , , , , , , , , , ,298, , , , , , , , , , , , , , , , , , , , , , , , ,860.08
90 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Bill And Kelly Montgomery President'S Associates 23, David And Carrie Butler President'S Associates 19, David And Lauren Perkins President'S Associates 24, Brad And Angela Hawley President'S Associates 25, H.H. Tripp And Kathy Wommack President'S Associates 25, Alba A. Ortiz And James R. Yates President'S 128, , The Texas Archeological Research Laboratory Tar! 12, Judge James R. Nowlin President'S Associates 25, , Bary Hutsell Fund 21 ' The Aragona Family Foundation President'S Associates 32, Betty Sue And Jon Newton President'S Associates 21 ' Anne And Steve Ballantyne President'S Associates 26, Cathy Lester It Excellence Memorial Award 29, June Marie Gallessich Dissertation Award In 46, Bob Brister Memorial Scholarship 128, , Bryan And Michelle Goolsby President'S Associates 27, Clair E. Krizov President'S Associates Endowment 47, College Of Natural Sciences Endowment For Excellence 403, Charles L. And Schatzie Nixon Tighe President'S 26, David Walter President'S Associates Endowment 16, , Earnest & Agnes Gloyna and Family President's Associates Endowment 33, Jim & Laura McBride President's Associates Endowment 21, , Paul Somerville Pres Associates Endowment Funded by Houston Livestock 110, Susan & Steven West President's Associates Endowment 25, , Mr. And Mrs. Lawrence Pope President'S Associates Endowment 43, Creekmore & Adele Fath Excellence Fund in Humanities Resource 2,762, Creekmore & Adele Fath Excellence Fund in American History Resource 2,762, Creekmore & Adele Fath Excellence Fund in Foreign Language Study 5,524, Scurlock Foundation Exhibition Endowment 313, , James & Claudia Richter Chair in Global Health Policy 952, , Reagan Silber President's Excellence Fund Endowment 51, Zlotnik Fammily Chair in Entrepreneurship 2,095, Shirley Bird Perry Endowment Fund for University History 206, , TOTAL INSTITUTIONAL SUPPORT 160,660, , Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , (3,886.34) 27, , , , ,859, , ,859, , ,718, , , , ,088, , , , ,169, , (84, ) 161, ,626, , ,221, SCHOLARSHIPS AND FELLOWSHIPS Malcolm Abel Centennial Endowed Scholarship In 26, The Abeii-Hanger Foundation Endowed Presidential 149, Wayne Abramson Endowed Presidential Scholarship 85, Floy Agnew Endowed Presidential Scholarships 161, , , , , , , , ~
91 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August31, N Net Position Gift Additions to September 1, 2012 Endowments Floy Agnew Scholarship At The University Of Texas, 240, Truett Airhart Endowed Scholarship In The College Of 23, Alamo City Endowed Scholarship For Pianists 28, Blake Alexander Traveling Student Fellowship In 94, George W. Allen Memorial Loan Fund 35, Nassar I. AI-Rashid Endowed Presidential Scholarship 88, American Assoc. Of University Women Fellowship Fund 190, Burdine Clayton Anderson Scholarship In Music 32, Christine W. Anderson Scholarship 49, Anonymous Endowed Presidential Scholarship No , School Of Architecture Scholarship And Fellowship 267, Tom Arnold Endowed Presidential Scholarship In Law 143, William C. Arrington Centennial Endowed Scholarship 233, Art Appreciation Endowed Scholarship In Museum 31, Lear Ashmore Fellowship In Communication Disorders 30, Belle Clayton Atkeisson Scholarship 25, E. Bagby Atwood Memorial Graduate Scholarship In 67, , Austin Ad Club Endowed Scholarship In Advertising 32, Gilbert H. Ayres Fellowship In Chemistry 103, Beverly Thompson Bailey Centennial Memorial 30, , Douglas And Gladys Bailey Centennial Endowed 83, Rex G. Baker, Jr. Centennial Endowed Scholarship 38, Anne And Steve Ballantyne Endowed Scholarship 30, The Mort Baranoff Endowed Scholarship 51, Lillian Barkley Scholarship Fund 33, , John W. Barnhill, Jr.--Biue Bell Creameries, Inc 116, Baron And Budd Endowed Presidential Scholarship In 407, Laura Thomson Barrow Graduate Fellowship 665, Joseph F. Barthmaier, Jr. Memorial Scholarship 15, Lucy Barton Scholarship 34, Basketball Seniors' Scholarship 41, The Bates, Broocks, Border, Roberts Endowed 117, William James Battle Fellowship In Greek 915, W. J. Battle Scholarship In Classical Languages 21, Harriet F. Batts Art Scholarship And Loan Fund 11, George W. Bean Endowed Presidential Scholarship In 144, Henry Beckman Fund Endowed Presidential Scholarship 96, The Henry Beckman Scholarship In Mathematics For 100, Carl Stone Benedict Scholarship Fund 161, David Alan Benfield Memorial Scholarship In 138, Gordon Clark Bennett Endowed Scholarship In Human 329, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 8, , , , , , ' , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions (12,804.61) , , Net Position August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,233.71
92 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Belle And William Benson Memorial Scholarship 29, L. Joe Berry Memorial Fund 38, , C. W. Besserer Memorial Endowed Presidential 266, Charles 0. Betts Scholarship In Law 2, Jack Binion Scholarship In Law 132, Frank And Fern Blair Fellowship Fund 102, , William B. Blakemore li Centennial Fellowship 153, Terrell Blodgett Endowment For Government Services 239, Emily Isbell Blunk Endowed Scholarship In Finance 31, W. D. Blunk Endowed Presidential Scholarship 93, Frank Bobbitt Memorial Scholarship In Law 27, Alys Jones Bodoin Centennial Endowed Scholarship 29, Mary D. Bold Scholarship Fund 162, The Herbert S. Bonham Law Scholarship 131, Memorial Scholarship Fund In Honor Of Botany Faculty 114, , Wayne Franklin Bowman Endowed Presidential 367, The Wayne Franklin Bowman Fund 39, Hal Box Endowed Scholarship In Architecture 145, J. Lassen Boysen Scholarship Trust 35, George W. Brackenridge Loan Fund 62, Brahman Energy Company Scholarship 65, John E. Breen Endowed Presidential Scholarship In 73, Florence Ralston Brooke Austin High School 47, Florence Ralston Brooke Scholarship In English 61, Brown Scholarship Fund 65, Ronald M. And Marilou D. Brown University Scholarship 196, Dr. Louis R. Bruce/Or. Linda J. Hayes Scholarships 63, Jesse L. Brundrett Memorial Endowed Presidential 123, David Bruton, Jr. Endowment For Graduate Fellowships 1,409, David Bruton. Jr. Graduate Fellowships In Mathematics 1,825, W. J. Bryan Prize In Government 32, Judge Jerry Buchmeyer Endowed Presidential 81, John Buck Company And First Chicago Investment 52, Max And Mary Anne Burlage Fellowship Burleson Texas History Prize 7, Adele Steiner Burleson Loan- Scholarship Fund For 488, Albert Sidney Burleson Loan- Scholarship Fund 614, Thomas Frederic Bush Scholarship Fund James A. Bush Scholarship Fund 1,552, Dr. And Mrs. Ernest C. Butler Endowed Presidential 267, Ira Butler Endowed Presidential Scholarship In Law 121, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31,2013 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,462, , , ,893, , , , , , , , , , , , , , , , , ,607, , , , , , c,.)
93 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 ~ Net Position Gift Additions to September 1, 2012 Endowments The Cba Students' Endowed Presidential 61, The Graduate Business Students' Endowed 145, Dr. And Mrs. Ernest C. Butler Centennial Endowed 218, Cabot Educational Grant In Journalism 52, Earl Campbell Endowed Presidential Scholarship 101, Dorothy Ogden Carsey Memorial Scholarship 527, , Carroll Cartwright Endowed Presidential Scholarship 107, Lilia M. Casis Fellowship Fund 41, Carol Diane Cave Memorial Endowed Presidential 115, The Cba Students' Endowed Presidential 62, Eloise Helbig Chalmers Endowed Scholarship In Music 35, JohnS. Chase Endowed Presidential Scholarship 256, Chemistry Faculty-Regents Scholarship And Fellowship 210, Joe And Tan a Christie Endowed Presidential 107, Dr. Anson L. Clark Endowed Presidential Scholarship 72, Emma Frances Clark Fellowship In Psychology 109, George L. Clark Scholarship Fund 2,598, W. Kenley Clark Memorial Endowed Presidential 154, Class Of '58 Endowed Presidential Scholarship In Law 46, Class Of 1962 Endowed Presidential Scholarship 37, Earnest E. And Elsie M. Clawson Endowed Scholarship 70, Tom Clendenin, Jr. Memorial Scholarship In Law 25, Mary E. Cleveland Centennial Endowed Presidential 122, Dr. And Mrs. C. L. Cline Endowment Fund 15, The Colonel And Mrs. Guy M. Cloud, li Scholarship 524, Virginia And Ernest Cockrell, Jr. Fellowships In 8,469, Virginia And Ernest Cockrell, Jr. Scholarships In 40,613, ,279, Harry Cohen Endowed Scholarship 36, College Bowl Scholarship Fund 38, Mr. And Mrs. Marvin K. Collie Endowed Presidential 89, Marvin Key Collie Endowed Presidential Scholarship In 249, Whitfield J. Collins Endowed Presidential Scholarship 180, C. C. And Lottie Mae Colvert Fellowship 716, John P. Commons Teaching Fellowship 225, Concert Hall Named Seat Endowed Scholarship Fund 97, E. P. Conkle Endowed Scholarship 32, Conocophillips Scholarship 83, Barbara Smith Conrad Endowed Presidential Scholarship 213, The Jody Conradt Endowed Presidential Scholarship 94, Bettie P. Cook Endowed Scholarship In Plan li 37, Cecil N. Cook Endowed Presidential Scholarship In Law 80, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , , , , , , , , , (56.55) 1, ' , , , , , , , , , , , , , , , , , , , , , , ,689, , , , , , , , , , , , , , , , , , ' ,850, ,424, ,318, , , , , , , , , , , , , , , , , , , , , , , , , , , , ,692.91
94 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments C. W. Cook Endowed Presidential Scholarship 106, Frances Crain Cook Endowed Presidential Scholarship 120, Mrs. Sam G. Cook Endowed Scholarship 48, Mary Frances Bowles Couper Endowed Presidential 119, Mary Frances Bowles Couper Endowed Presidential 119, Ainslee Cox Scholarship In Music 24, Ann Lacy Crain Scholarship Fund 33, W. H. Deacon Crain Endowed Presidential Scholarship 76, Roy Crane Award In The Arts 121, Crawford Endowed Scholarship 696, Cora Crawford Scholarship Fund 52, John L. And Anne Crawford Endowed Presidential 92, Ruth Smith Crawford Centennial Scholarship 41, , Roberta P. Crenshaw Centennial Endowed Scholarship In 32, The Silky And Harry Crockett Endowed Presidential 152, Raymond V. And Lucy Cruce Endowed Scholarship In 102, , Gregor Cruickshank Family Endowed Scholarship 26, Anna Hughes Cunningham Endowed Presidential 74, Earl W. Cunningham Endowed Presidential Scholarship 132, William A. And Mary B. Cunningham Scholar. In Chemical 346, Robert H. Cuyler Endowed Presidential Scholarship 208, Dads' Association'S Patron Endowed Presidential 101, The Bela Foundation Scholarship Fund 659, John Wallace Dallenbach Fellowship In Psychology 217, Karl M. Dallenbach Scholar Ship In Psychology 7, Daughters Of The American Revolution Scholarship Fund 56, C. J. Davidson Scholarship Fund 945, Wilbur S. Davidson Educational Fund 1,070, Carolyn Kay Katie Davis Memorial Scholarship Fund 97, Marian B. Davis Endowed Scholarship In Art History 36, Norris G. Davis Scholarship Fund 60, Wilda And Raymond Dawson Endowed Presidential 74, Kate J. Decherd Bible Scholarship Fund 25, Ethel V. Loving De Diaz Scholarship Fund 67, Dedman Merit Scholars Program Endowment 15, , Ronald K. Deford Field Scholarship Fund 637, , Albert J. Delange Memorial Endowed Presidential Donna Dellinger Memorial Scholarship Fund 41, Ruth Denney Endowed Presidential Scholarship In Charles Robert Devall Journalism Award The Lyde And Charles Devall Endowed Presidential 92, Net Increase Investment (Decrease) In Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 3, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,108, , , , , , , , , , , , , , ,400, , , , , , , , , , , , , "1
95 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than Stale As of August 31, 2013 co (J) Net Position Gift Additions to September 1, 2012 Endowments The Richard M. And Helen Devos Scholarship For 25, Thomas J. Dimiceli Endowed Presidential Scholarship 77, Thomas J. Dimiceli Endowed Presidential Scholarship 76, Thomas J. Dimiceli Endowed Presidential Scholarship 79, Thomas J. Dimiceli Endowed Presidential Scholarship 71, The Mrs. Kate Polk Dimmitt Memorial Scholarship Fund 37, Jorge Luis Divino Centennial Scholarship In 82, Edward Louis Dodd And Alice Laidman Dodd 244, Sarah Dodson Endowed Scholarship In English Mr. And Mrs. Robert P. Doherty, Jr. Regents Chair In 4,249, Dr. James C. Dolley Endowed Presidential Scholarship 179, Lois Donaldson Endowed Presidential Scholarship In 30, E. William Doty Scholarship Fund 22, The James R. Dougherty And Rachael Dougherty Vaughan 171, Robert R. Douglass Memorial Endowed Presidential 80, Dow Centennial Endowed Presidential Scholarship For 82, Dow Chemical U.S.A. Centennial Endowed Presidential 121, Dow Chemistry Alumni Centennial Endowed Scholarship 47, Dow Engineering Alumni Centennial Endowed 248, Department Of Drama Ex- Students Scholarship 42, Clara Driscoll Scholarship For Research In Texas 136, Michael Bruce Duchin Centennial Memorial Endowed 165, H. A. Ted Dulan Scholarship 60, The James Leonard Duncan Memorial Scholarship Fund 48, Almetris M. Duren Endowed Presidential Scholarship 88, Florence Durrett Endowed Presidential Scholarship 72, Mary Ellen Durrett Scholarship In Child Development 210, Back Sandra Dyche Endowed Presidential Scholarship 141, W. E. Dyche Endowed Presidential Scholarship 147, Robert E. Eakin Endowed Centennial Scholarship 121, The John And Catherine Early Endowed Scholarship 95, Marquis G. Eaton Accounting Education 366, Frederick Eby Research Prize In Humanistic Studies In 21, Maxine Smith Elam Centennial Endowed Scholarship Fund 91, Electrical Engineering Visiting Committee Centennial Alexander Caswell Ellis Fellowship In Education 2,342, Temple Foundation Graduate Mcd Fellowships In 1,580, Pharmacy Alumni Association Endowed Scholarship 1,816, , Engineering Foundation Endowed Undergraduate 375, Engineering Foundation Endowed Graduate Fellowship 238, Engineering Foundation Endowed Graduate University Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , , , , Net Position August31, , , , , , , , , , ,398, , , , , , , , , , , , , , , , , , , , , , , , , ,465, ,643, ,883, , , ,745.47
96 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Engineering Foundation Endowed Graduate Presidential 720, Temple Foundation Graduate Fellowship Fund 415, Mccombs Mba Endowed Presidential Scholarship 85, Engineering Foundation Endowed Undergraduate 565, Engineering Doctoral Fellowship Endowment 7,322, Mr. And Mrs. Frank Craig Erwin, Jr., Endowed 79, W. H. Espey Memorial Endowed Presidential Scholarship 97, Courtney J. Evers Centennial Endowed Presidential 94, Ewing And Worzel Graduate Fellowship 1,392, The Ex-Students' Association Endowed Scholarships 2,523, Ellen Mcangus Ezell Scholarships In Accounting 401, Sally Carruth Farley Scholarship 49, E. D. Farmer International Scholarship Fund 1,263, Felsing Memorial Fund 26, William Russell Young, Jr. Centennial Scholarship 31, Judge Joe J. Fisher Chief Judge Endowed Presidential 289, J. Anderson Fitzgerald Endowed Presidential 97, Peter T. Flawn Endowed Presidential Scholarships 161, A. Odell Fletcher Endowed Presidential Scholarship 99, John Arnold Focht And Fay Goss Focht Endowed 85, Constance Forsyth Scholarship In Printmaking 40, Lois Sager Foxhall Memorial Fund 220, Catheryne S. Franklin Centennial Endowed Scholarship 65, William B. And Geraldine Franklin Friend Of Alec 45, Da\ies Frantz Endowed Scholarship Fund 29, Michael Frary Endowed Scholarship In Painting 153, Ralph E. Frede Public Relations Foundation Of Texas 45, I. Friedlander Building And Loan Prize 33, Friends Of Chemistry-Regents Scholarship And 90, William Fritz Scholarship In Law 16, Benjamin And Dorothy Fruchter Centennial Award For 36, E. Gus Fruh Memorial Fellowship Fund 53, The Bascombe Royall And Frances Fallon Fuller 158, B. N. Gafford Electrical Engineering Scholarship Fund 36, Basdall Gardner Memorial Graduate Mcd Fellowships In 1,795, Homer Garrison Endowed Scholarship In Liberal Arts 36, Ellen Clayton Garwood Scholarship Fund 33, Garwood Centennial Scholarship In Art Song 29, Ben Davis Geeslin Endowed Presidential Scholarship 74, L. A. Bunk Gibbs Scholarship Fund 62, , T. J. Gibson, Iii Endowed Presidential Scholarship In 79, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August31, , , , , , , , , , , , , , ,616, , , , , , , , , ,444, , ,612, , , , , , ,308, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,869, , , , , , , , , , , , , ) ""
97 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, Net Position Gift Additions to September 1, 2012 Endowments Thomas J. Gibson lv Endowed Presidential Scholarship 74, Dr. Taylor Clyde Gilbert And Mrs. Edythe Erhard 4,744, Annie Barnhart Giles Centennial Endowed Presidential 99, Annie B. Giles Endowed Scholarship Fund In Music 47, Clarence E. Gilmore Prize 17, Earnest And Agnes Gloyna Endowed Presidential 92, , Frances Eggleston Goldbeck Scholarship 133, Gloria J. Gonzalez Memorial Scholarship Fund 47, The Good Right Arm Advertising Scholarship For Women 32, Alice B. Goodwin Scholarship Fund 86, The Graduate Business Students' Endowed 130, Miss Effie Graves Scholarship Fund 103, Frank Graydon Scholarship Fund In Accounting 194, Great American Reserve Scholarship For Community 227, Guy E. Green Endowed Presidential Scholarship 176, Chief Justice Joe R. Greenhill Endowed Presidential 248, Margaret Halm Gregory Centennial Scholarship 29, Mary Cornelia Gregory Scholarship 20, Anne Haskins Grousbeck Scholarship For Academic 79, John Guerin Centennial Endowed Scholarship Fund 36, H. E. B. Grocery Company Endowed Presidential 71, H. E. B. Grocery Company Endowed Scholarship In Food 42, H. E. B. Grocery Company Endowed Scholarships In Food 201, Charlie And Eunice Haas Endowed Presidential 76, Fred E. And Nora V. Haas Endowed Presidential 87, Karl Frederick Hagemeier, Jr. Memorial Endowed 112, The Martha B. Hahn Endowed Scholarship 36, Edward E, And Kathryn L. Hale Scholarship Fund 169, Lysbeth Ann Martin Hale Endowed Presidential 92, The Ray Hall Advertising Fellowship 132, Elizabeth L. And Russell F. Hallberg Foundation 62, Bettie Johnson Halsell Endowed Presidential 127, Marsha L. Hamby Memorial Scholarship 83, Marie B. Hanna Endowed Scholarship 197, The Dr. Ralph And Marie B. Hanna Centennial Endowed 308, Dr. Ralph And Marie B. Hanna Endowed Scholarship In 352, Rosemary Walling Harmon Memorial Scholarship 28, Nee I Harrington Memorial Scholarship 68, Charles Harritt, Jr., Endowed Presidential 254, Carl Gottfried Hartman Graduate Fellowship Endowment 385, Lurae Harvey Endowed Scholarship 25, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 2, , , , , , , ' , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , (43,218.84) (202,881.19) , Net Position August 31, , ,911, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,789.03
98 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Robert Austin Hatcher Endowed Scholarship 39, Bess Heflin Fellowship Fund 211, Ross H. And Annie Seymour Hemphill Endowed 29, The Joseph L. Henderson And Katherine D. Henderson 563, George Herbert Endowed Scholarship 89, Joseph Martin Hernandez Jr. Memorial Scholarship 6, James L. And Emily D. Musgrove Endowed Scholarship 29, Isabell Smith Herzstein Endowed Presidential 75, George Stuart Heyer Scholarship Fund 319, Lena And John Edward Hickman Endowed Presidential 5, Prentice Hill- Deacon Crain Scholarship Fund For 27, The Betty Himmelblau Endowed Scholarship For Women'S 122, Hinds-Webb Scholarship Fund 171, Patrick Hines Endowed Scholarship 36, James F. And Bernice M. Hinton Endowed Presidential 577, Francis Hodge Endowed Scholarship In Drama 63, Elizabeth Brown Hodges Endowed Presidential 29, The Governor And Mrs. James Stephen Hogg Memorial 405, Richard Holdsworth Memorial Scholarship Fund 64, Frank M. Holloway Endowed Presidential Scholarship 175, John B. Holmes Scholarship 182, John B. Holmes Endowed Presidential Scholarship In 66, Mary E. Gearing Human Ecology And Council Scholarship 109, Lily Rush Walker And Coulter Hoppess Scholarship In 127, Houston Chapter-American Petroleum Institute 424, , Houston Livestock Show And Rodeo Endowed Scholarship 1 '170, Wayne R. Howell Endowed Presidential Scholarship In 212, Virginia Mcbride Hudson Endowed Scholarship 58, Talbot S. Huff, Sr. Highway Engineering Graduate 169, William 0. Huie Endowed Presidential Scholarship In 48, Hultz-Whittle Outstanding Student Award 33, Charles E. Hurwitz Centennial Fellowship 1,210, Ray And Kay Bailey Hutchison Endowed Presidential 68, Dwight E. Huth Endowed Presidential Scholarship In 195, Wendell C. Gordon Endowed Graduate Fellowship 447, Interfraternity Council Scholarship Fund 42, Moses And Adell raison Scholarship Fund 12, The Jodie And Mary Isenhower Endowed Presidential 376, Robert M. Jackson Scholarship Fund In Journalism 98, W. A. James Scholarship Fund 82, Lloyd A. Jeffress Memorial Fellowship Fund 212, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 1, , , , , , , , , , , , , , , , , , , , (51,578.68) 73, , , , , , , , , , , , , , , , " 181, , , , , , , , , , , , ,211 ' , , , , , , , , ' , , ,252, , , , , , , , , , , , , , , , , , co c.o
99 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31,2013 CD Janet C. And Wolf E. Jessen Endowed Presidential Wolf E. Jessen Endowment Fund In Fine Arts Claudia T. Johnson Journalism Scholarship Mr. And Mrs. J. Russell Johnson Scholarship Fund Marion Johnson-South Texas Section Society Of Plastic Edwin M. Jones Scholarship Fund Jesse H. Jones Centennial Scholarship And Fellowship Jesse H. Jones And Mary Gibbs Jones Endowed Jesse H. Jones And Mary Gibbs Jones Endowed John Tilford Jones, Jr. Endowed Presidential Judge Marvin Jones Endowed Presidential Scholarship Barbara C. Jordan Endowed Scholarship In Women'S Marian Royal Kazen Endowed Presidential Scholarship John Lewis Keel Memorial Scholarship Fund Carolyn Frost Keenan Endowed Scholarship Judge Quentin Keith Endowed Presidential Scholarship Randy Kelleher Endowed Scholarship Fund Winchester Kelso Endowed Presidential Scholarship In Lorrin G. And Laura D. Kennamer Endowed Presidential Alfred A. And Ellen U. King Centennial Scholarship In Alfred And Nellie King Graduate Fellowship Anna Nauwald King Endowed Scholarship Joe J. King Professional Engineering Achievement Joe J. King Centennial Endowed Presidential Robert D. King Dean'S Distinguished Graduates Endowed George M. Kozmetsky Memorial Endowed Presidential Ronald D. Krist Endowed Presidential Scholarship In Fania Kruger Fellowship Joe D. Kubicek Memorial Scholarship In Engineering August Kunz Family Scholarship Endowment Fund Nathan Sommers Jacobs Endowed Presidential National Student Business League Endowed Scholarship Richard N. Lane Scholarship Fund The Charles W. Laughton Endowed Presidential Bobby Layne Scholarship Fund Addison E. Lee Fellowship Vestal Lemmon Endowed Presidential Scholarship H. J. Leon Graduate Fellowship In Classics Roger L. Levy Endowed Presidential Scholarship In Law The Margaret Jane Mckinney Lewis Fellowship In Liberal Arts Council Endowed Scholarship For Study Net Position September 1, , , , , , , ,807, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 3, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , Net Position August 31, , , , , , , ,870, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,536.12
100 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Joe P. Liberty Endowed Scholarship In Plan li 26, Linneas Of Texas Swedish Centennial Endowed 71, H. L. Lochte Fellowship/Scholarship 166, Lockhart Scholarship In The Graduate School Of 40, Cornelia And Meredith Long Centennial Scholarship 73, Pansy Luedecke Scholarship Fund 73, E. J. Lund Founders Fund 2,043, David And Doris Lybarger Endowed Scholarship In 53, John H. And Lujza P. Mccammon Endowed Scholarship 42, Mildred Masters Mccarty Scholarships In Greek And 34, Mr. And Mrs. L. F. Mccollum Scholarship In 76, Mr. And Mrs. L. F. Mccollum Scholarship In 21, Arch H. Mcculloch Endowed Presidential Scholarship In 29, Eugene Mcdermott Texas Excellence Award For 703, John E. Mcgary Advertising Scholarship 17, Karl And Helen Mcginnis Scholarship 53, R. A. Mcketta Centennial Endowed Presidential 87, Nancy Francis And William Arnold Mcminn Endowed 102, Nancy Francis And William Arnold Mcminn Endowed 98, Dr. John 0. Mcreynolds Memorial Award In Pre-Medical 26, J. Hoover Mackin Memorial Scholarship 86, Alma Walsh Mallison Endowed Presidential Scholarship 103, C. R. Smilo Mallison Endowed Presidential Scholarship 452, John E. Mankin, Sr.-Texas Cable Tv Association, Inc 123, Roberto Marquez And Rogelio Garcia Endowed 30, Cora Merriman Martin Scholarship Fund 71, Alex H. Massad Endowed Presidential Scholarship 167, Lucy May Maxey Student Loan Fund For Nursing 182, Ward C. Mayborn Journalism Scholarship 31, Will H. Mayes Scholarship In Journalism 530, Mike And Maxine K. Mebane Endowed Traveling 3,870, Graduate Fellowship In Medieval Studies 118, Mercedes-Benz/Clarissa Davis Endowed Scholarship 60, Hispanic Business Student Association Endowed 41, W. F. And Marian Michael Scholarships And Fellowships 129, , Michaux Scholarship Fund 38, The James A. Michener Fellowships In Writing 7,812, Grace Hill Milam Endowed Presidential Scholarship 84, Ada Frances Miller Endowed Graduate Scholarship In 210, Carl R. Miller Journalism Scholarship Fund 30, Carroll C. Miller Endowed Presidential Scholarship 112, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , , , , , , , , , , ,115, , , , , ' , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,030, , , , , , , , , , , ,086, , , , , , , <0 3, , "
101 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than Stale As of August31, 2013 <D N Net Position Gift Additions to September 1, 2012 Endowments David L. Miller Graduate Fellowship In Philosophy 37, Emily Maverick Miller And Emily Miller Wells Endowed 283, Lourania Miller Scholarship In Greek Or Latin 25, Roger Q. Mills Scholarship 553, James W. Moll Endowed Presidential Scholarship In 94, Leah Moncure Memorial Scholarship Fund 188, , Fred H. Moore Endowed Presidential Scholarship 140, Sallie Beth Moore Scholarship 82, Walter L. And Reta Mae Moore Graduate Fellowship In 183, Walter L. And Reta Mae Moore Graduate Fellowship In 168, M. B. Moran Endowed Presidential Scholarship In 91, The Robin Bruce Moran Memorial Centenni- AI Endowed 96, Frank Morrow Endowed Presidential Scholarship In 165, William Carter Morrow Scholarship In Law 25, J. Ludwig Mosie Memorial Scholarship Fund 190, Motorola Endowed Scholarship 55, Maggie C. Murchison Delta Kappa Gamma Scholarship 29, Layton B. Murphy Memorial Presidential Scholarship 69, Benonine Muse Scholarship Fund 133, Music Endowment Fund 171, Eugenie Kamrath Mygdal Endowed Scholarship In 36, Jeanette Balagia Nader Memorial Scholarship In 30, Robert Scott Neblett Scholarship 193, William Negley Endowed Presidential Scholarship In 66, Johanna Schmitz Nelson, George Estill Martin, Amanda 489, Ralph R. Nelson Presidential Scholarship Fund 823, Willie Nelson Endowed Presidential Scholarship 130, Joseph And Annie Wright Netzer Memorial Scholarship 11, V. F. Neuhaus Endowed Presidential Scholarship 85, Mrs. V. F. Gertrude Neuhaus Endowed Presidential 122, Fred K. Newberry Scholarship In Law 18, The Graduate Business Students' Endowed 123, Virginia Nokes Endowed Presidential Scholarship In 133, Kay M. Nolen Memorial Endowed Presidential 128, Laverne Noyes Foundation Scholarship Fund 197, Delta Phi Epsilon- Tillie Oderbolz Scholarship 16, Donald M. Oenslager Endowed Scholarship 26, Shiela M. O'Gara Scholarship Fund 23, J. Pat O'Keefe Memorial Scholarship Fund 26, Charles D. Oldright Fellowship In Philosophy 129, The Leaton Thomas Oliver Scholarship Fund In Chemical 552, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions Net Position August 31, , , , , , , , , , , , , , , , , , , , , , ' , , , , , , , , , , , , , , , , , , ,194.55
102 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments David L. Olm Centennial Memorial Scholarship 31, S. H. Osmond Scholarship Fund Ed. Owen- Geo. Coates Fund 409, Panhellenic Scholarship Fund 127, Sam W. Papert, Jr. Endowment For Media Sales 85, Troy Randall Parish Scholarship Fund 135, , James H. Parke Memorial Scholarship Fund 30, Clara M. Parker Delta Kappa Gamma Scholarship 33, Marjorie Davisson Parker Endowed Scholarship And 32, Frank Thomas Patillo Centennial Lectureship 64, Jane Marie Tacquard Patillo Centennial Lectureship 82, Carole L. Patterson Endowed Scholarship For 136, Perry And Tommie Patterson Fellowships In Political 165, Peabody Scholarship In Education 50, Louis M. Pearce, Jr. Endowed Presidential Scholarship 308, Angus G. And Erna H. Pearson Undergraduate 93, Lora Lee Pederson Fund 30, Pennzoil And Pogo Producing Companies-William E 507, , J. J. Jake Pickle Scholarship Program 4,621, York Rite Masonic Scholarship Fund 157, Pitkin Endowed Scholarship 62, Valerie Popper Scholarship Fund 27, William L. Prather Scholarship 24, Dr. Blanche Prejean Endowed Presidential Scholarship 89, Rita C. Pringle Scholarship In Law 25, Charles Prothro Centennial Scholarship Fund 146, Eleanor And Robert Pulver Scholarship 38, Raymond F. Rabke, Jr. Scholarship 32, Hal H. Ramsey Iii Memorial Fund 49, Mattie B. Randall Scholarship Fund 54, B. M. Mack Rankin, Jr., Scholarship Fund 242, Jewel Popham Raschke Endowed Presidential Scholarship 292, The Rase Brothers Award In Chemical Engineering 31, Louis W. Rase And Sophie Braun Rase Scholarship Fund 22, Dewitt T. Ray, Sr. Endowed Scholarship 361, Ralph R. Read Endowed Scholarship For Undergraduate 321, Dewitt Reddick Journalism Scholarship Fund 142, Emmette S. Redford Fellowship Fund 280, Regents Endowed Graduate Fellowships In Mathematics 1,556, Helmut And June Rehder Graduate Scholarship Fund 97, Peter L. Reid Memorial Scholarship 44, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31,2013 1, , , , , , , , , , , , (4.17) , , , , , , , , ,698,21 2, , , , , , , , , , , , , , , , , , ,783, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,614, , , , , c.o w
103 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 '. Net Position Gift Additions to September 1, 2012 Endowments The University Of Texas At Austin Retired 583, , Charles Donnell Rice Scholarship In Mathematics 8, George Rice Scholarship At The University Of Texas 173, The Wayne And Marjorie Riddell Endowed Scholarship 35, Melvin J. Rieger Scholarship Fund In Physics 626, F. Riggs Memorial Endowed Presidential Scholarship 97, Pearl M. Riggs Endowed Presidential Scholarship In 64, Eugene A. Ripperger Scholarship Fund 62, Frank Rizzo Advertising Scholarship 31, Lynda B. Johnson Robb Award 33, Wilhelmina Pegram Robertson Scholarship Fund 889, Debbie Ann Rock Scholarship In Interior Design 123, James M. Rockwell And Sarah Wade Rockwell 615, John 0. And Cathryn Rodgers Endowed Scholarship Fund 59, A. Louise Rogers Scholarship In Law 26, Verna M. Harder Endowed Presidential Scholarship In 78, Lorene L. Rogers Endowed Presidential Scholarship 86, The Will Rogers Memorial Scholarship Fund 480, Stanley And Sandra Rosenberg Endowed Presidential 43, Michael P. Rosenthal Endowed Presidential Scholarship 46, Darrell Royal Centennial Endowed Presidential 91, Darrell Royal Endowed Presidential Scholarship 285, Darrell Royal Endowed Presidential Scholarship In 73, Darrell Royal Endowed Presidential Scholarships In 153, Charles Rubert Scholarship 24, Grace Rebecca Rubert Scholarship 21, George I. Sanchez-Marres Endowed Presidential 79, Charles L. Sandahl, Jr. Endowed Scholarship For 71, Steven Sanders Scholarship Fund 94, E. M. Scarbrough Loan Fund 69, Maurice J. Schaded Memorial Scholarship 77, Aaron Schaffer-Giovanni Podia-Jason Sokolosky 41, Louis And Elizabeth Scherck Geology Scholarship 295, Vernon T. Schuhardt Centennial Memorial Scholarship 56, Wally Scott Endowed Scholarship Fund 465, Deloitte Haskins And Sells Glenn A. Welsch Endowed 56, , Murray Case Sells Foundation Student Loan Fund 1,293, Frances Rather Seybold And Frances Randolph Rather 67, Sylvia Shapiro Scholarship 33, Charles Morton Share Trust Graduate Fellowship Fund 382, Charles Morton Share Trust Scholarship 117, Net I ncr ease Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,338, , , , , , , , ,641.93
104 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than Stale As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Michael C. Shea, Jr. Memorial Scholarship Fund 66, Shell Oil Company Foundation Endowed Presidential 59, Marietta Daniels Shepard Memorial Endowed 120, Effie Potts Sibley Endowed Scholarship Fund 384, Ascher Silberstein Scholarship 41, Jonas And Dora Silberstein Scholarship Fund 17, F. W. Simonds Endowed Presidential Scholarship 107, Stanley H. And Kathleen F. Simonsen Fellowship In 133, Kenneth Sims Endowed Scholarship For Women'S 69, The Judge John Singleton Endowed Presidential 29, Clint C. Small, Jr. Endowed Presidential Scholarship 146, John Witherspoon Slaughter Endowed Memorial 33, Lomis And Jennie Slaughter Scholarship In Music 30, Amy Gaston Smith And Beulah M. Smith Centennial 48, Bryant Smith Loan-Scholarship Fund 616, Reverend E. G. Cap Smith Scholarship 31, Glenn Smith Memorial Scholarship Endowment 373, Lee Lytton Smith Scholarship Fund 47, Mamie E. Smith Endowed Presidential Scholarship 85, Marie Smith Regents Endowed Scholarship In Chemistry 97, Mrs. Sidney Burleson Smith Endowed Presidential 66, Southland Paper Mills Foundation Endowed Scholarship 357, Spain-Leff Memorial Scholarship Fund 24, Ralph Steiner, M.D., Loan- Scholarship Fund For 562, The Fred Steinmark Fund 70, Judge Ross Sterling Memorial Scholarship 31, Beaumont Stinnett And Faith Foundation Junior Fellows 72, Bettie Jo Stock Scholarship In Law 18, Carl And Agnes Stockard Memorial Endowment Fund 180, Ben H. Stough, Jr. Endowed Scholarship 48, Archie W. Straiten Endowed Presidential Scholarship 98, Esther M. Straiten Endowed Presidential Scholarship 67, Strasburger And Price Centennial Faculty Fellowship In 154, RobertS. Strauss Fellowship Fund 1,266, RobertS. Strauss Endowed Presidential Scholarship 1,319, Robert C. Strong, Jr. Memorial Scholarship In The 32, Marcus Leon Strum Centennial Scholarship 30, Student Endowed Centennial Lectureship 465, Student Memorial Scholarship Fund 65, University Of Texas At Austin Student Deposit Endow 5,629, Murray Endowed Scholarship In Theatre Studies 80, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 2, , , , , , , , , , , , , , , , , , , , , ' , , , , , , , , , , , , , , , , , , , , , , , , , , , ' , , , , , , , , , , , , , , , ,311, , ,366, , , , , , , , , , ,826, (!) 2, , CJ'1
105 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 co (]) Net Position Gift Additions to September 1, 2012 Endowments Jennie And Carl Sundberg Scholarship Fund 160, Elizabeth Mcgoldrick Surginer Endowed Scholarship 416, August Gus N. Swain Endowed Scholarship 97, Harlan Tad Sutherland Memorial Scholarship Fund 129, Dr. Stephen A. Szygenda Centennial Scholarship In 33, Sol Taishoff Memorial Endowed Scholarship In 90, Tobi And Tina Taub Endowed Scholarship 26, Jack G. Taylor Endowed Presidential Scholarship 68, Dean T. U. Taylor Endowed Fellowship Fund In 78, T. U. Taylor Foundation Endowed Presidential 133, T. U. Taylor Endowed Presidential Scholarship In 95, Larry Temple Scholarship Endowment 1,324, T. L. L. Temple Foundation Scholarships 29, Texas Alpha Educational Foundation Of Pi Beta Phi 169, Texas Exes In Human Ecology Scholarship Fund 60, Texas Federation Of Women'S Clubs Scholarship 37, Texas Sesquicentennial Endowed Fellowship In History 39, DavidS. Thayer Memorial Scholarship Fund 100, Thompson And Knight/Harold F. Kleinman Endowed 122, J. Neils Thompson Graduate Fellowship In Structural 102, Thomas Thompson Journalism Scholarships 142, Judge Homer Thornberry Endowed Presidential 31, Mollie Fitzhugh Thornton Music Scholarship Fund 43, Richard Thornton Memorial Scholarship In Criminal Law 5, Los Angeles Times Scholarship Fund 381, JoeL. Tad Chemical Engineering Scholarship 153, Charles W. Tolbert Endowed Presidential Scholarship 103, Tracor/Frank Mcbee, Jr. Scholarship Endowment 1,838, Lois Trice Endowed Scholarship In Plan li 675, Laura Duncan Trim Scholarship In Music 35, Harry Trueblood Foundation Scholarship In Petroleum 441, , Carl R. Trull Endowed Presidential Scholarship In 49, Elizabeth Anne Tucker Centennial Scholarship 29, Louis Richard Turbeville, M.D., Endowed Presidential 79, Trigg And Fannie E. Twichell Centennial Endowed 97, Uniden Corporation Of America Endowed Scholarships In 1.401, Udden Memorial Scholarship Fund 56, Charles Umlauf Centennial Endowed Scholarship Fund James Mcnutt Mac Umstattd Endowed Presidential 122, United Daughters Of The Confederacy Scholarship 48, University Ladies Club Centennial Endowed 184, , Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 5, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions Net Position August 31, , , , , , , , , , , , ,371, , , , , , , , , , , , , , , ,902, , , , , , , , ,450, , , , , ,093.29
106 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Ut Law Wives Scholarship In Law 26, Glenn And Martha Vargas Gemological Scholarship In 48, James W. Vick Endowed Presidential Scholarship In 104, Annie Whittenburg Walker Memorial Endowed 175, , Stanley Walker Memorial Award In Journalism 11, Joe C. Walter, Jr. Endowed Presidential Scholarship 68, Lois Philip Ware Scholarship In Memory Of Her Father, 34, Lois Philip Ware Scholarship In Memory Of Her Mother, 45, David M. Warren And Alvah Meyer Warren Journalism 172, Wayne Weber Memorial Endowed Presidential Scholarship 30, Louis Weisberg Memorial Chemistry Scholarship 68, William Byron And Frances Combs White Endowed 60, J. M. West Texas Corporation Fellowship In 106, W. Gordon Whaley Graduate Fellowship 392, The John A. Wheeler Fellowship In Physics 305, Robert Leon White Memorial Fund 27, J. E. Whiteselle Navarro County Students Fund 28, Whiting Endowed Presidential Scholarship In 70, Dr. F. L. Whitney Memorial Scholarship Fund 196, Sam G. Whitten Memorial Endowed Presidential 63, Anne Wilkens Memorial Scholarship Fund 44, Dr. James T. Willerson Endowed Scholarship Fund 260, J. Robert Wills Endowed Graduate Fellowship In The 163, Stanley P. And Claudie P. Wilson Endowed Presidential 135, Hal John And Judy Wimberly Memorial Scholarship In 68, , James W. Winkel Memorial Endowed Presidential 88, The Loren Winship Scholarship 32, Witt Family Scholarship Fund 57, Eva Stevenson Woods Endowed Presidential Scholarship 6,053, Neena M. Woolrich Endowed Scholarship Fund 99, , Richard Worley Endowed Fellowship In Economics 460, , Lola Wright Foundation Centennial Endowed Scholarship 36, Lola Wright Foundation Centennial Scholarship Fund In 84, N. K. Wright Memorial Endowed Presidential 82, R. Earle Wright Endowed Presidential Scholarship In 88, Fleet And Chester Wynne Endowed Presidential 70, Orville Wyss Endowed Scholarship Fund 44, Charles E. Yager Undergraduate Field Scholarship Fund 186, Fern Marlies Younger Endowed Scholarship For Women'S 113, Igor Youskevitch Endowed Scholarship In Drama 29, The Zoology Scholarship Endowment For Excellence 797, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , ' , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , (120,958.78) 299, ,232, , , , , , , , , , , , , , , , , , , , , , , , <0 27, ,
107 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 < William Balfour Franklin And Geraldine Franklin Charles Conradt Memorial Endowed Scholarship Locke Liddell And Sapp Lip Endowed Presidential The Robert M. Gray Scholarship Fund Judge Carl 0. Bue, Jr. Endowed Presidential Elizabeth L. And Russell F. Hallberg Foundation Victor And Myra Ravel Social Work Scholarship In Allen F. Jacobson Endowed Scholarship In Engineering Willya L. Cantrell Scholarship S The E. N. Ernie Hensen Memorial Scholarship In The Carrie Lee Kennedy Fellowship The Oliver William Kennedy Fellowship Maurice W. Acers Endowed Presidential Scholarship In Lucy M. Moore Endowed Presidential Scholarship In Law Judge Jerre S. Williams Endowed Presidential Helen And Milton SmithiMoshana Foundation Endowed Margaret B. Kennedy And Ernest C. Kennedy Scholarship John W. Halsey, Jr.IDiane Shaughnessy Schlecte Betty Yarnell Brown Endowed Presidential Scholarship Wilbur L. Matthews Endowed Presidential Scholarship Dorothea Bennett Memorial Graduate Fellowship Fund Edmund J. And Charlene Gleazer Endowed Scholarship In Judge Wilson Cowen Endowed Presidential Scholarship Clinton F. Morse Endowed Presidential Scholarship In Ellen Waters Olson Endowed Presidential Scholarship Judge Thomas M. Reavley Endowed Presidential Terrell H. Hamilton Endowed Graduate Fellowship Judge Ben H. Powell Award Janet Guthrie Andrews Endowed Presidential Robert N. Noyce Memorial Fellowship Thrust 2000 Engineering Graduate Fellowship Fund Robert D. Cresap Endowed Presidential Scholarship Rodney W. Ludwig Endowed Scholarship In The College Thomas A. Rousse Memorial Fund Barbara Jordan Scholars Program Gilbert I. Low Endowed Presidential Scholarship In Wes Ogden Memorial Scholarship In Geophysics Eli Goldstein Endowed Presidential Scholarship In Law Charles Ely Lankford Memorial Scholarship Fund Hispanic Chamber Of Commerce Of Travis County Endowed The Kathryn Gurley Scholarship Endowment Net Position September 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,111, ,263, , , , , , , , , , '102, Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 4, , , , , , , , , , , , , , , , , , , , , , , , , , , ,135, , , , , , , , , , Net Other Additions/ Deductions , Net Position August 31, , , , , , , , , , , , , , , , , , , , , , , , , , ,424,58 173, , , ,186, ,513, , , , , , , , , , '140,930.29
108 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments David A. Lingle Endowed Presidential Scholarship In 51, Ryoichi Sasakawa Young Leaders Fellowship Fund 2,319, James W. Winkel Memorial Scholarship 351, va Spencer Finton Scholarship 705, Joanne M. Ravel Regents Endowed Fellowship In 195, The Betsy Rawls Scholarship 53, Emory T. Peterson And Ella E. Peterson Endowed 419, Alvin Owsley Endowed Presidential Scholarship In Law 164, Babe Zaharias/ Carlette Guidry/ Leigh Ann Fetter 56, Dowell Vann Allen Memorial Endowed Scholarship In 26, Travis County Medical Auxiliary And Society Endowed 90, Carl Illig Endowed Presidential Scholarship In Law 197, America Paredes Endowed Scholarship 112, Graduate Business Students' Endowed 118, Darwin D. Klingman Endowed Scholarship 55, Baker And Penny Mcadams Endowed Presidential 127, George Hannon Endowed Scholarship 92, Michael R. Daley Endowed Presidential Scholarship For 84, Louis E. De moll Endowed Presidential Scholarship 107, Thomas A. Loomis Endowed Presidential Scholarship 165, Edgar W. White, Jr. Endowed Scholarship 90, Jean Raleigh Kindle And W. L. Pup Kindle Endowed , The Dow Chemical Company-University Of Texas Alumni 364, Forrest Gober Endowed Presidential Scholarship In 55, Margaret Orr Woodyard Endowed Presidential 57, Texaco Incorporated Endowed Presidential Scholarship 77, A. Donald And Eleanor Sellstrom Fund For Excellence 33, Peggy Whalley Endowed Scholarship 32, Sue Ann Ray Culver Endowed Presidential Scholarship 67, W. N. Kirby Endowed Scholarship For Future Teachers 25, Arthur Lockenvitz Memorial Endowed Scholarship In 91, Louis E. Rosier Memorial Undergraduate Scholarship In 45, Texes Alumni Centennial Scholarship Fund For Teachers 38, The Jim Watson Endowed Presidential Scholarship 86, Jody And Crockett Slover Endowed Scholarship 23, Albert And Anice Vanderlee Endowed Scholarship Fund 397, Richard J. Connelly College Of Education Centennial 29, The Boylan Family Scholarship 46, Maureen M. And Richard E. Wakeland Endowed 21, V. Bennett, Jr. Endowed Scholarship 67, Raymond Estep History Scholarship Fund 120, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 1, , , ,400, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , <0 4, , <0
109 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, Net Position Gift Additions to September 1, 2012 Endowments Joyce M. Burg Endowed Presidential Scholarship Law 78, Forrest C. Lattner Endowed Scholarship Fund 1,580, Edith Blanche Jennings Burns, Rn. Endowed Scholarship 232, Steve K. Sin Endowed Presidential Scholarship In 54, Joanne Marye Thaman Endowed Presidential Scholarship 243, Whitworth-Hollaway Endowed Scholarship 63, The Franklin Myers Endowed Presidential Scholarship 78, Dean Leon Green Endowed Presidential Scholarship In 76, Jere W. Thompson Endowed Presidential Scholarship 85, Frances Goff Scholarship Fund 256, Faraday Fellowship 106, Sidney M. Wright Endowed Presidential Scholarship 105, Charlie Haas Family Endowed Presidential Scholarship 78, David Bruton, Jr. Endowment For Undergraduate 1,505, Terry And Sue Tottenham Endowed Presidential 83, Charles And Elizabeth Tigar Endowed Presidential 78, The Charles S. Sharp Endowed Presidential Scholarship 157, Thomas C. Unis Endowed Presidential Scholarship In 102, Elton M. Hyder, Jr. Scholarship In Law An Endowed 30, Carl Parker Endowed Presidential Scholarship In Law 82, Beirne, Maynard, And Parsons Endowed Presidential 137, Campbell A. Griffin Endowed Presidential Scholarship 157, David J. Beck Endowed Presidential Scholarship In Law 104, Samuel George Cook Memorial Endowed Presidential 93, Dr. Bailey R. Collins/EIIene Collins Ward/Mary Sue 2,399, Bartlett Cocke Scholarships 267, Jack G. Taylor Memorial Endowed Presidential 674, The Limited Editions Club Endowment 252, Sue Brandt Mcbee Scholarship Award For Excellence 87, Elizabeth Olds Scholarship Fund In Conservation 134, David Price Endowed Presidential Scholarship In Art 77, Jack G. Taylor Memorial Endowed Presidential 683, Kirstin Torgerson Endowed Presidential Scholarship In 73, Charles E. Kolodzey Endowed Presidential Scholarship 124, Osmar A bib Memorial Endowed Presidential Scholarship 387, Carolyn Frost Keenan Endowed Presidential Scholarship 81, School Of Nursing Faculty-Staff Endowed Presidential 113, , Mitzi I. Nuhn Dreher Endowed Presidential Scholarship 91, The Johnson And Gibbs, A Professional Corporation, 76, Oscar And Ethel Schwartz Endowed Presidential 115, , Audre And Bernard Rapoport Liberal Arts Honors 3,007, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 2, , , , , , , , , , , , , , , , , , , , , , , , (1 05,840.88) 9, , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , Net Position August 31, , ,635, , , , , , , , , , , , ,558, , , , , , , , , , , ,294, , , , , , , , , , , , , , , , ,113,524.18
110 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments State Bar Of Texas Construction Law Section Endowed 92, Peter John Layden And Professor WilletT. Conklin 111, Mary Gibbs Jones Endowed Presidential Scholarship In 81, Joe Roddy, Jr. Headliners Foundation Scholarship In 78, Steve Barton And Denny Berry Endowed Presidential 86, Professor William W. Gibson, Jr. Endowed Presidential 77, Dean Ira P. Hildebrand Endowed Presidential 77, Adele Lorusso Memorial Scholarship Fund 41, Dean John F. Sutton, Jr. Endowed Presidential 83, Pea Health Plans Endowed Presidential Scholarship 114, Michener Fellowship Program 22,966, Seaborn Eastland Endowed Scholarship 110, Basi Endowed Scholarship And Fellowship 109, Gsdandm Endowed Presidential Scholarship In Advertising 76, Norman Hackerman Endowed Presidential Scholarship In 82, Charles C. Keeble And Charles C. Keeble, Jr. Endowed 75, Knopf Fellowship Program 220, Natural Sciences 21St Century Endowed Presidential 489, Martha S. Williams Endowed Presidential Scholarship 106, Norman Campbell Endowed Presidential Scholarship In 91, Carmage And Martha Ann Walls Endowed Presidential 143, George W. Marshall, Jr. Memorial Endowed Presidential 88, Cullen Trust For Higher Education Endowment Fund 1,500, Logan Wilson Regents Graduate Fellowship In Academic 120, Nacds Endowed Presidential Scholarship In Pharmacy 81, , James R. Alexander Endowed Presidential Scholarship 67, Thomas H. Godfrey Endowed Presidential Scholarship In 83, Sarah And Jack Gurwitz Endowed Presidential Gus Macey Hodges Endowed Presidential Scholarship In 98, Judge Harry Lee Hudspeth Endowed Presidential 83, Orlando Letelier And Ronni Karpen Moffrtt Endowed 134, John H. Crooker, Jr. Endowed Presidential Scholarship 87, Tom Martin Davis Endowed Presidential Scholarship In 204, George Pierre Gardere Endowed Presidential 205, Oveta Culp Hobby Endowed Presidential Scholarship In 115, William P. Hobby Endowed Presidential Scholarship In 115, Jenkens And Gilchrist Endowed Presidential Scholarship 114, George E. Seay Endowed Presidential Scholarship In Sander W. Shapiro Endowed Presidential Scholarship In 114, Herbert F. And Vivian V. Singletary Endowed 156, Robert Smith Davis And Lyall Pickett Davis 22, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 3, , , , , , , , , , , , , , , , , , , , ,773, , , , , , , , , , , , , , , , , , , , , , , ,553, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~
111 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, \.) Net Position Gift Additions to September 1, 2012 Endowments Hemphill-Gilmore Scholarship Fund 1,363, Heman Sweatt Endowed Presidential Scholarship In Law 97, Louann Atkins Temple Endowed Presidential Scholarship 157, David Glasson Hewlett Scholarship In Business 50, Sarah Hewlett Radkey Scholarship In Education 51, Louise Shelley Hewlett Brame Scholarship In Human 51, David Hubbard Hewlett Scholarship In Law 50, Louisa Frances Glasson Hewlett Scholarship In Music 51, Arthur Lefevre, Sr., Memorial Scholarship In 127, Walter Benona Sharp Memorial Scholarship In 149, Joseph S. Cullinan Memorial Scholarship In Geological 151, James Lockhart Autry Memorial Scholarship In Law 126, Estelle Boughton Sharp Memorial Scholarship In Human 129, ma Hogg Memorial Scholarship In Human Ecology 138, Harry And Mar Siu Gee Endowed Presidential 76, Mack G. And Beatrice C. De Leon Endowed Presidential 103, Class Of 1942 Endowed Presidential Scholarship In Law 123, Scott And Nancy Atlas Endowed Presidential 76, Lisa Atlas Genecov And Dr. JeffreyS. Genecov Endowed 75, Atlas And Hall Endowed Presidential Scholarship In Law 77, Thomas B. Ramey, Sr. Endowed Presidential Scholarship 77, Thomas M. Phillips Endowed Presidential Scholarship 95, Nelson Phillips Endowed Presidential Scholarship In 77, Marion And Mark Martin Endowed Presidential 78, Jesse P. Luton, Jr. Endowed Presidential Scholarship 115, Corwin W. Johnson- Class Of 1964 Endowed 150, Clarence Leon Carter Endowed Presidential Scholarship 189, John Winston Carter Endowed Presidential Scholarship 189, Clarence Leon Carter And John Winston Carter Endowed 189, Class Of '63 Endowed Presidential Scholarship In Law 78, Class 01'66 Endowed Presidential Scholarship In Law 332, Israel Dreeben Endowed Presidential Scholarship In 76, Judge Reynaldo Garza Endowed Presidential Scholarship 106, Judge Thomas Gibbs Gee Endowed Presidential 225, Bob Gibbins Endowed Presidential Scholarship In Law 254, William N. Hamilton Endowed Presidential Scholarship 76, Nathan Koppel Endowed Presidential Scholarship In Law 107, , Richard Mithoff Endowed Presidential Scholarship In 102, Keith Morrison Endowed Presidential Scholarship In 94, Michael W. Perrin Endowed Presidential Scholarship In 75, Wally Scott Endowed Presidential Scholarship In Law 135, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 47, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , Net Position August 31,2013 1,411, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,552.29
112 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Judge Bob Shannon Endowed Presidential Scholarship In 83, Judge Joseph T. Sneed Iii Endowed Presidential 85, Judge Dorwin W. Suttle Endowed Presidential 79, Judge Mace B. Thurman, Jr. Endowed Presidential 76, Jesse And Peggy Vaughter Endowed Presidential 100, Ralph W. Yarborough Endowed Presidential Scholarship 311, Judge Robert M. Parker Endowed Presidential 307, , Everett Hutchinson Endowed Presidential Scholarship 81, Anderson Endowment 650, Neill And Beverly Walsdorf Endowed Presidential 78, V. Bennett, Jr. Endowed Scholarship Fund 73, Leon Danielian Endowed Presidential Scholarship In 187, Patsy Cater Deaton Endowed Presidential Scholarship 84, Noble And Dorothy Doss, Sr. Endowed Scholarship 73, Marguerite Fairchild Endowed Presidential Scholarship 141, John And Suanne Roueche Endowed Scholarship In 722, , Rita Willner Atlas Endowed Presidential Scholarship 190, A. David Renner Endowed Presidential Scholarship In Betty J. Bomar Endowed Presidential Scholarship In 362, Dr. Louis Edward And Virginia Steele Brenz 27, Hugh Liedtke Endowed Scholarship In Business 1,406, Joanne Sharp And Jack R. Crosby Endowed Scholarship 1,415, Lee Hage And Joseph D. Jamail Endowed Scholarship In 1,385, M. K. Hage Endowed Scholarship In Fine Arts 1,414, Lee Hage And Joseph D. Jamail Endowed Scholarship In 1,483, Gale White Endowed Fellowship In Geophysics 865, Robert Jeffry Womack Endowed Presidential Scholarship 200, Pauline Camp Operatic Voice Scholarship Byron E. Short Endowed Presidential Scholarship In 122, Carol Cave, Cathy Cave Cartwright, And Allison Cave 49, Bergen Brunswig Corporation Endowed Presidential 80, John A. And Katherine G. Jackson Fellowship In 508, Frank N. Edmonds, Jr. Memorial Fellowship 26, Glenn And Martha Vargas Endowed Presidential 88, Larry A. Holmes- South Texas Section, Society Of 80, Christie Paige Wagner Endowed Presidential 139, Medco Health Solutions, Inc. Endowed Presidential 165, Donald T. And Gwen Rippey Endowed Scholarship In 186, Margie And William H. Seay And Sarah M. And Charles 20, Baker And Mary Montgomery Endowed Scholarship 73, Patricia And Ralph Thomas Endowed Presidential 80, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31,2013 2, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , (187.51) 750, , , , , , , , , ,456, , ,464, , ,434, , ,464, , ,535, , , , , , , , , , , , , , , , , , , , , , , , , , , ~ 2, , , , "'
113 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, ~ Net Position Gift Additions to September 1, 2012 Endowments Anne Vickery Stevenson-Edward D. Vickery, Jr. Endowed 119, , Amanda Howze Amsler Endowed Presidential Scholarship 241, , Don M. Lyda Endowed Presidential Scholarship Fund 76, Johnson And Johnson Endowed Graduate Fellowship In 166, G. D. Searle And Company Endowed Fellowship In Pharmacy 157, Thomas J. Dimiceli Endowed Presidential Scholarship 69, Michael And Susanna Steinberg Endowed Scholarship 513, The Richards Group Endowed Presidential Scholarship 78, Tracy-Locke/Morris Hite Endowed Presidential 505, The Mary A. Seller-Yantis Endowed Presidential 80, , Hoechst-Roussei/Howard B. Lassman Endowed 62, , lc2 Institute Eugene B. Konecci Endowed Internship 149, WilliamS. Livingston Graduate Fellowship Endowment 708, , College Of Education Centennial Endowed Presidential 79, Dr. Jerry And Janie Julian Endowed Scholarship Fund 36, Davis Milton Love, Jr. Memorial Endowed Scholarship 97, William R. Muehlberger Field Geology Scholarship Fund 317, , C. Paul Boner Graduate Fellowship In Physics 139, Lucille And Lester Harrell Endowed Scholarship 31, Anna Mae Hutchison Endowed Scholarship Fund 5,395, Lena Mom Nornhausser Stein Endowed Presidential 75, Hana And Eugene B. Konecci Endowed Presidential 85, Anna Hughes Cunningham Endowed Presidential 101, Mary Kate Kitty Collins Memorial Endowed Presidential 49, Fondren Endowed Scholarship In Music 88, E. W. Doty Endowed Presidential Scholarship In Music 187, , Margaret Dunlap Thompson Endowed Presidential 76, Frederick J. Hunter Endowed Scholarship In History 20, Robert C. Jeffrey Endowed Presidential Scholarship In 130, Robert Parker Endowed Scholarship 146, Happy Feller Endowed Scholarship 73, Robert L. Myer Endowed Scholarship 73, PatWeis Endowed Presidential Scholarship 93, Social Work Foundation Advisory Council Endowed 65, Helen Farabee Memorial Endowed Presidential 166, R. W. And Kathleen Lindsey Endowed Presidential 72, Palisades Geophysical institute Postdoctoral 1,279, Cam Graduate Fellowship Fund 14,979, Larry A. Holmes Endowed Scholarship In Chemical 25, Ase/Em Faculty Endowed Scholarship Fund 19, Alan And Nancy Hamm Endowed Presidential Scholarship 97, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August31, , , , (69.29) , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,584, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,330, , , ,678, , , , ,721.29
114 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Kent Kennan Endowed Graduate Fellowship In Music 2,026, Oscar G. Brockett Endowed Graduate Fellowship In 81, Maggie Dee Stell Endowed Scholarship Fund 1,906, James T. And Phyllis Doluisio Endowed Presidential 120, William W. Sullivan, Jr. Endowed Scholarship 19, Kyoon Hur Fellowship Fund 19, Legends Of Pharmacy GolfTournament Endowed 98, Leon 0. Morgan Fellowship 90, San Antonio Pharmacists Endowed Presidential 72, The Maxine And Jack Zarrow Foundation Endowed 70, H.W. Wilson Scholarship 72, I sora And Thomas Cooke Endowed Human Ecology 542, Engineering Leadership Service Award Fund 32, Tom W. White Endowed Scholarship 122, Minute Maid Company Endowed Scholarship 19, Graves, Dougherty, Hearon And Moody Endowed 75, Robert C. Drummond Endowed Presidential Scholarship 104, Kelly Fearing Endowed Presidential Scholarship In Art 77, Pat And Homer L. Luther, Jr. Endowed Presidential 48, Marshall F. Wells Scholarship And Fellowship 1,135, Houston Endowment Graduate Fellowship 301, Houston Endowment President'S Excellence Scholarships 1,169, Mary Winton Green Endowed Presidential Scholarship In 95, The Trammell Scholarship Endowment In Music 48, Georgia B. Lucas Endowed Presidential Scholarship In 72, The J. Tinsley Oden Faculty Fellowship Research Fund 7,122, Bernard And Audre Rapoport Endowed Presidential 74, Kae L. Brockermeyer Endowed Presidential Scholarship 146, Maurice R. Bullock Endowed Presidential Scholarship 128, Class Of '51 Endowed Presidential Scholarship In Law 73, Class Of '53 Endowed Presidential Scholarship In Law 81, John B. Connally Memorial Endowed Presidential 320, Frank Douglass Endowed Presidential Scholarship In 126, Ben And Mollye Glast Endowed Presidential Scholarship 73, Richard E. Gray, Jr. Endowed Presidential Scholarship 125, Tom Ingram Endowed Presidential Scholarship In Law 73, Albert P. Jones Endowed Presidential Scholarship In 58, Judge Bill Junell Endowed Presidential Scholarship In 160, Chris Marshall Endowed Presidential Scholarship In 183, William J. Steeger Endowed Presidential Scholarship 74, , Thompson, Coe, Cousins And Irons, L.L.P. Endowed 73, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , ,120, , , , ,973, , , , , , ,321,10 3, , , , , , , , , , , , , , , , , , , , , , , , , ,175, , , , ,210, , , , , , , , , ,424, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ( ,876.19
115 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 ~ 0 Q) Net Position September 1, Ken Woodward Endowed Presidential Scholarship In Law 310, Roslyn Wright Memorial Endowed Presidential 79, The Louis Jules Hexter Endowed Presidential 398, Anna Mae Ford Memorial Fund 53, Frank Den ius Endowed Scholarship 202, Heywooo Woody Mcgriff Endowed Presidential 194, Dallas Endowed Presidential Scholarship In Art 172, Whit Dudley Endowed Memorial Scholarship In Harp 41, Ernst And Young/Kenneth Leventhal And Company Endowed 52, Kay And Joel Levy Family Endowed Scholarship 72, Robert E. Veselka Endowed Fellowship For Graduate 129, Fredricka Crain Endowed Presidential Scholarship In 65, William Jack Hunley Endowed Scholarship 223, Virginia R. Allen Endowed Presidential Scholarship In 127, Jimmy Greenwood Memorial Golf Scholarship 71, Baldomero Vela, Sr. Endowed Presidential Scholarship 58, Anne And Oscar Mauzy Endowed Presidential Scholarship 72, Harry Ransom Distinguished Fellowship 378, Mary Margaret Blair Lindsay Endowed Scholarship 22, Alvin And Helene Eicoff Endowed Presidential 375, Paul C. Trickett, M.D., Endowed Presidential 64, Betty Osborn Biedenharn Endowed Presidential 82, Ari Yehiel Blattstein Endowed Presidential 75, Kristi Kana Endowed Presidential Scholarship In 75, Harold H. Hap Dalrymple Endowed Presidential 73, S.D. And Nancy, Darrell And Gwyn, Earle And Lisa, 241, Waller Creek Natural Science Park 26, Gordon Clark Bennett Endowed Scholarship 74, Leticia Flores Penn Endowed Presidential Scholarship 100, Doyle Professorship In Western Civilization 186, Robert E. Boyer Endowed Presidential Scholarship For 206, William Dente Endowed Memorial Scholarship In Opera 22, Delbert Stark Endowed Scholarship 42, Amelia And Lloyd Thacker Endowed Scholarship 19, Harry Estill Moore And Bernice Milburn Moore 316, Burdine Anderson Giese Endowed Scholarship In Studio 51, William Mozart Mcvey Endowed Scholarship In Sculpture 41, Lomis Slaughter, Jr. Endowed Scholarship In Sculpture 41, Abbott Laboratories Endowed Presidential Scholarship 52, Douglas A. Parker Memorial Endowed Presidential 112, Eckerd Endowed Presidential Scholarship In Pharmacy 77, Gift Additions to Endowments Net I ncr ease Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 10, , , , , , , , , , , , , , , , , , , , , , , ,567,86 8, , , , , , ' , , , , , , Net Other Additions/ Deductions , Net Position August31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,551.11
116 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments David Howard lvey Memorial Endowed Scholarship 21, Mark J. Belisle Family Endowed Scholarship 69, Warren Skaaren Endowed Presidential Scholarship 111, Susan Vaughan Foundation Endowed Scholarship In Art 143, Debra J. Herring Memorial Fellowship Fund 253, Debra Beth Lobliner Graduate Fellowship In 167, , William Edwards Douglass Endowed Presidential 81, Emily Knauss Graduate Scholarship For Liberal Arts 944, Bromley F. Cooper Endowed Fellowship 55, Susanne Spencer Skaggs Endowed Scholarship In Nursing 28, , Phillip Tacker Endowed Presidential Scholarship 60, Icc Mahatma Gandhi Memorial Scholarship 22, Eta Kappa Nu Endowed Scholarship In Electrical And 18, Robert Herman Endowed Scholarship 43, Joe C. Krejci Endowed Scholarship In Chemical 18, Lockheed Martin Endowed Scholarship 18, Sonya Clark Mcdonald Machemehl Endowed Presidential 58, Mary Buice Alderson Scholarship 790, Marion Elizabeth Eason Endowed Scholarship For The 23, Michael J6hn Fink, M.D. Endowed Presidential 145, Robert A. Merriii/Pricewaterhousecoopers Endowed 135, Michael Aubrey Jones Endowed Scholarship In Art 18, Kinder Morgan Excellence in Engineering Presidential Scholarship 105, Santa Rosa Children'S Hospital Scholarship Fund In 93, Jaime N. Delgado Endowed Presidential Scholarship In 51, Ralph R. Nelson Scholarship Fund 1,219, Charles Edwards Endowed Scholarship In Art History 74, David Garvey Scholarship Fund 18, Susan Ginsburg Hadden Fellowship Fund 124, Leon And Mimi Toubin Family Endowed Scholarship 66, Rusty And Bill Duvall Endowed Scholarship 66, Estelle C. And Alfred R. Bob Rochs Endowed 66, Joe Conley Bowling Endowed Scholarship 17, Robert G. Greer Family Endowed Scholarship 17, Lewis Brazelton Endowed Scholarship 17, Pricewaterhousecoopers Accounting/Long- Horn Band 33, J. Sam Winters Endowed Presidential Scholarship 44, Denton A. Cooley, M.D. Endowed Scholarship 132, The Cba Students' Endowed Presidential 51, Roberta Wright Reeves Excellence Endowment In Liberal 5,236, , Carl 0. Bergquist Endowed Scholarship 29, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,262, , , , , , , , , , , , , , , , , , , , , , , ~ 183, ,769, , , !
117 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, OJ Net Position Gift Additions to September 1, 2012 Endowments Barbara Sublett Guthery Endowed Scholarship 64, Coleman A. Jennings Endowed Presidential Scholarship 252, Legends Of Pharmacy GolfTournament Endowed 95, David L. Mcwilliams Endowed Scholarship 64, Sally C. Paul Fellowship 73, Weldon And Mary Smith Endowed Scholarship 26, Dr. Charles A. Walton Endowed Presidential 130, The Richard Warren Mithoff Endowed Presidential 178, Ann Schumacher Adkins Scholarship In German-Texas 41, Van M. Smith Endowed Presidential Scholarship In 60, Sublett Capital Ventures, Inc. Endowed Presidential 43, E. P. And Virginia Conkle Endowed Scholarship In 20, Alma And Leonard Orth Endowed Scholarship Fund 194, Helen Milam Hughes Endowed Presidential Scholarship 43, Educational Psychology Endowed Scholarship Fund 29, Wm. Arlyn And Mary Carol Kloesel Endowed Presidential 98, Sarah Young Hengst Endowed Scholarship 17, Aida R. Hilliard, R.N. Memorial Endowed Presidential 66, Steven And Cabrina Owsley Endowed Scholarship In Acting 85, , Oglesby Prize Endowment 120, Chris Gilbert Endowed Football Scholarship 16, Benjamin K. Lewis Endowed Scholarship In Business 74, Mary Elizabeth Sands, M.D., And ArthurT. Sands, 18, Lloyd Allen David Endowed Presidential Scholarship 308, Keene Prize For Literature 2,577, James Carlyle Thompson, Iii Golf Memorial Endowed 31, Rae R. And Margaret S. Burton Endowed Presidential 181, Century Club Endowed Presidential Scholarship 43, Walter P. Schuetze/Kpmg Endowed Presidential 84, Thad W. Riker Scholarship 110, Edward Taborsky Scholarship 110, Carolyn Hixson Harris Endowed Presidential 167, , Carl J. Eckhardt Memorial Endowed Scholarship In 32, Wallace H. Scott, Jr. Endowed Scholarship 28, Fred Winfield Day, Jr. Endowed Scholarship In 111, V. Bennett, Jr. Endowed Presidential Scholarship 163, Ralph B. And Patricia Thomas Endowed Presidential 41, Jpmorgan Chase Endowed Presidential Scholarship 36, Jane Dillard Hanger/Tex Robertson Endowed 103, Lucille Roan-Gray Endowed Presidential Scholarship In 41, Gordon C. And 0. V. Bennett, Jr. Endowed Scholarship 62, Investment Income Net Increase Investment (Decrease) In Fair Income (Realized Value of Gains and Investments Losses) 2, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , (100.36) Net Position August 31, , , , , , , , , , , , , , , , , , , , , , , , , ,668, , , , , , , , , , , , , , , , ,957.45
118 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Ann Caswell Allison Endowed Presidential Scholarship 63, Comerica Bank- Texas Endowed Presidential 36, Thomas H. And Joan P. Davenport Endowed Scholarship 33, Henry R. And Elizabeth Sledge Henze Endowed 28, Michael And Jeanne Lee Klein Endowed Scholarship In 132, Michael And Jeanne Lee Klein Endowed Presidential 132, Joseph H. Culver Endowed Presidential Scholarship 53, J. W. Red Mccullough, Jr. Endowed Presidential 133, Alice Duggan And David Caldwell Gracy Endowed 81, Marvin E. And Anne Price Beck Endowed Scholarship 42, E. W. Doty Endowed Presidential Scholarship In Fine 88, , Karyn Diane Cameron Endowed Presidential Scholarship 145, , Burl Gordon Rogers Endowed Presidential Scholarship 102, Louise And Ira lscoe Endowed Presidential Scholarship 88, Robert P. Cooke Memorial Endowed Scholarship In 52, Margie Nornhausser Hale/Mick Haley Endowed 96, Pinto Carver Endowed Scholarship 79, Betty Bullington Threadgill Scholarship Fund 20, Texas Union Student Awards Endowment 160, , Judy Haralson Endowed Scholarship 33, Louis F. Southerland Endowed Scholarship 78, Aia Austin Charles Moore Endowed Scholarship 39, Eugene L. And Judy Vykukal Endowed Presidential 52, E. P. Schoch Endowed Presidential Scholarship In Band 85, Richard L. Nelson Memorial Endowed Presidential 79, , Stacie Maureen Sowell Endowed Presidential 60, Entergy Endowed Presidential Scholarship In Women'S 63, Alice R. Redland Memorial Endowed Presidential 41, Earlene Fulmer Endowment 35, Juanita And Travis Porter Basketball Scholarship 14, Woody And Donna Mccasland Family Endowed Scholarship 156, David A. Ott Family Endowed Scholarship 75, Allee, Asher, Anson, Austin And Axton Reilly Endowed 208, Caroline And Claire Straty Endowed Scholarship 16, Jack Perry Memorial Endowed Scholarship 62, Amoco Ut Alumni Scholarship In Engineering 21, Irving And Jeannette Goodfriend Endowed Presidential 77, Bernard And Audre Rapoport Endowment For 2,586, Chad Oliver Memorial Scholarship In Plan li 65, Gilbert R. Satterwhite Memorial Scholarship Endowment 32, , Oliver H. Bown Endowed Fellowship In Educational 16, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August31,2013 2, , , , , , , , , , , , , , , , , , , , , , , (40.13) , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,676, , , ~ 1, , , co
119 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ 0 Net Position Gift Additions to September 1, 2012 Endowments Bernice And Saul Manaster Endowed Fellowship In 27, Eckerd Endowed Presidential Scholarship In Pharmacy 65, Robert L. Riviere Endowed Scholarship 31, Dolores Lorraine Alberts Memorial Scholarship 16, Ece Senior Fellows Endowed Scholarship 18, Susan T. Jastrow Outstanding Undergraduate Nutrition Scholar Award 28, Maxine Foreman Zarrow Endowed Faculty Fellowship In 205, Allison Lord Widhelm Memorial Endowed Scholarship In 20, Harris L. Marcus Graduate Fellowship In Materials 18, Mary Farris Gibson Endowed Presidential Scholarship 71, Lake/Fiato Endowed Scholarship 32, Norma White, R.N. Endowed Scholarship In Nursing 28, Victor M. Aguilar Memorial Endowed Scholarship 83, Dvcrrexas Aerospace Industry Endowed Scholarship 16, Renee Wolfe Zelman And Norman Zelman Endowed 652, Roy M. Matney Endowed Presidential Scholarship 35, Ray M. Sommerfeld Memorial Endowed Presidential 96, A. T. Ted Ten Broeke Memorial Endowed Presidential 43, Gsb Class Of Steven C. Linder Memorial 72, Ben And Melanie Barnes Endowed Scholarship 70, Dallas Texas Exes Endowed Scholarship 52, Houston Texas Exes Athletic-Academic Services Endowed 113, Knox Nunnally Endowed Scholarship 14, San Antonio Texas Exes Endowed Scholarship 80, Ted Barnhill Endowed Scholarship 47, B. M. Mack Rankin Golf Scholarship 58, Howard Creel Golf Scholarship 78, Peter Gardere Endowed Scholarship 34, Amber, Justin And Kristen Hartley Endowed Scholarship 15, Bill And Corinne Heiligbrodt And Family Endowed 209, , Thomas 0. Hicks Family Endowed Scholarship 232, Ryan C. Holder Tennis Memorial Scholarship 48, Klein Family Endowed Scholarship 57, G.C. Ox Emerson Endowed Scholarship 79, Lee And Milton And Rochelle And Max Levit Endowed 55, Jim Lyle Endowed Scholarship 99, John Mackovic Endowed Scholarship 30, Meek Family Endowed Scholarship 23, Robert K. Moses, Jr. Endowed Scholarship 54, Motorola-Austin Endowed Scholarship 31, Mike Perrin Endowed Scholarship 54, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,246.75
120 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Warren J. Raymer, M.D. Endowed Scholarship 15, Joe C. Thompson Memorial Endowed Scholarship 148, The Mr. And Mrs. Robert Utley Iii And The Utley Group 142, Bryan Wagner And Duer Wagner, Jr. Endowed Scholarship 49, Stephen Butter Endowed Scholarship 12, Bibb Falk Memorial Baseball Scholarship 15, Jack D. Furst Endowed Scholarship 12, Barry Goodfriend, M.D. Football Scholarship 15, Dixie Ann Chambliss Harlow Endowed Scholarship 15, The Allan C. King Family Endowed Scholarship 13, Robert Bobby Layne Endowed Scholarship 15, Frank Medina Memorial Endowed Scholarship 15, John And Alexandra Mehos Endowed Scholarship 12, Cissy Parker Endowed Scholarship 15, Travis Roach Memorial Endowed Scholarship 15, Tex Robertson Swimming Endowed Scholarship 30, Barbara White Stuart Endowed Scholarship 14, Mary And Dick Watt Endowed Scholarship 12, Carolyn And John H. Young Endowed Scholarship 14, Risa Parker Endowed Scholarship 15, Glenn Swenson Endowed Scholarship 19, Charles G.S. Lewis Endowed Scholarship In Engineering 70, Louise Lewis Lee Endowed Scholarship In Liberal Arts 70, Paul Dewitt Connor And Ruth Patton Connor Endowed 41, H. Douglas Steadman Fellowship In Structural 25, , Ernst And Young/Ray M. Sommerfeld Memorial Endowed 51, Daryl Alan Hays Memorial Endowed Presidential 60, League For Innovation In The Community College 115, Hank Franklin Endowed Scholarship In Mechanical 27, Richard M. Clark Endowed Scholarship 15, Webster Smalley Endowed Scholarship In Drama 22, Derek Jon Schaver Memorial Endowed Scholarship 41, James A. Michener Publishing Fellowship 215, Karl Henize Memorial Scholarship Fund 17, Eugene Wisdom Memorial Scholarship In Actuarial 53, Marion Macbeth Endowed Presidential Scholarship In 38, Robert Carl Nesbitt Memorial Endowed Presidential 78, F. A. Matsen Graduate Fellowship In Physics 156, Sidney P. Chandler, Jr. Endowed Scholarship 15, Keenan Endowed Presidential Scholarship 58, Second Carolyn Frost Keenan Endowed Presidential 58, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,039.93
121 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ N Net Position Gift Additions to September 1, 2012 Endowments Jeffrey M. Heller Endowed Swimming Scholarship 507, Carlo And Angeline Visco Endowed Scholarship In 19, Frederick D. Klein Endowed Presidential Scholarship 71, University Cooperative Society Scholarship Endowment 30, George Pierre Pete Gardere, Jr. I Ut Parents' 41, Herbert F. Poyner, Jr. Endowed Presidential 71, Kent And Linda Mccormack Scholarship In Physics 38, Fallon B. Vaughn Tennis Scholarship 366, Joan A. Middleton Endowed Scholarship In Geology 18, Rose/Silverthorne Endowed Presidential Scholarship 153, W. C. Dusty And Doris Duesterhoeft Endowed 42, , Wagner Schwing Endowed Presidential Scholarship In 87, Matilda Weeden Barker Scholarship In History 21, Mrs. George P. Garrison Anne Perkins Garrison 21, Alia Ray Morris Scholarship Endowment 167, The Eddie Medora King Award For Musical Composition 526, George H. Gentry Iii Endowed Presidential Scholarship 89, Tom And Beverly Gerding Endowed Presidential 144, Mr. And Mrs. Jan Klinck Endowed Presidential 52, Mr. And Mrs. C. L. Klinck, Jr. Endowed Presidential 37, Bill D. Holland Endowed Presidential Scholarship In 79, Fernando F. Gonzalez Endowed Presidential Scholarship 54, Judith J. Saklad, Pharm. D. Endowed Presidential 40, The Wm. Arlyn And Mary Carol Kloesel Endowed 55, The Carol May And James C. Thompson Scholarship In 29, Addison A. And Mary E. Wilkinson Endowed Presidential 124, , Mr. And Mrs. Alonzo Z. Laurel Endowed Scholarship In 19, ' Leonard And Abby Zeifman Graduate Fellowship In Child 33, Jim Koeller Endowed Presedential Scholarship In 16, William L. Hays Endowed Fellowship In Educational 82, Charlie L. And Doris B. Brown Scholarships In Honor 262, Leila Tannous Endowed Scholarship In Nursing 24, Roy D. Pena Endowed Scholarship In Communication 70, Jose M. Luna Endowed Undergraduate Scholarship 13, Susan Claire Howard Memorial Endowed Presidential 67, Joseph F. Short Memorial Molecular Biology Endowed 24, Randy R. Richardson Endowed Scholarship 14, Richard And Marjorie Nelson Endowed Scholarship 49, , Elizabeth Lanham Endowed Presidential Scholarship 574, JoAnn Cutler Sweeney Endowed Presidential 101, Peggy Bess Miller Prewitt Endowed Scholarship 14, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,388.06
122 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Graduate Art History Endowed Scholarship 126, Steven Lowell Spinner Internship Fund 59, George M. Page Endowed Graduate Fellowship 87, Harry Debutts Page Endowed Fellowship In Marine 70, Henrietta Chamberlain King Endowed Scholarship 39, Capital Area Pharmacy Association Endowed Scholarship 24, Mexican-American Association Of Pharmacy Students 26, Paul And Margaret Kehrer Endowed Presidential 48, Ami Lunsford Memorial Scholarship In Victim Services 22, Joe And Betty Frost Endowed Presidential Scholarship 30, Chari A.M. Broquet Memorial Endowed Scholarship Fund 21, Pharmacy Class Of Endowed Scholarship In 15, Professor And Mrs. Hubert S. Wall Endowed 165, , Howard And Maydelle Causby Endowed Scholarship 14, Maralyn S. Heimlich Scholarship Fund 85, Sembradores De Amistad De Austin Endowed Presidential 84, , Kaplan Endowed Scholarship In Community College 117, John W. Barnhill, Iii Endowed Presidential 36, Betsy Barnhill Newman Endowed Presidential 36, Enloe Endowed Scholarship In Education 25, Mary Farris Gibson Memorial Scholarship In Music 24, H. Wayne Rudmose Endowed Graduate Fellowship In 142, Asian Business Students Association Endowed 14, Kemp-Forman Memorial Scholarship Fund 621, Lillian M. Collins And Everett F. Collins Endowment 16, Marlene H. Weitzel, Phd, Rn, Endowed Student 17, , Stanley And Ada Belle Fudell Endowed Presidential 34, Gladys Watford Endowed Scholarship 117, Lee'S Pharmacy And Medical Equipment Company Endowed 43, Lorene Soape Endowed Scholarship In Pharmacy 38, Renee Balas Bullard Endowed Scholarship In Pharmacy 31, , C. M. Armstrong Scholarship Fund 142, ElliotVDavis Endowed Scholarship Fund 49, Frank P. And Louise B. Wood Endowed Presidential 34, Stephen M. Karas Endowed Scholarship In Mechanical 23, Elizabeth Shatto Massey Scholarship In Education 315, Jess A. Pinson Endowed Scholarship In Chemical 15, Brandon Shaw Memorial Endowed Scholarship 167, , King S. Stephens Memorial Scholarship In Social Work 15, Terry Hemeyer Student Endowment 67, John M. Scott Endowed Presidential Scholarship In 109, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , ,14Q,96 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~ 3, , ~ "'
123 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~.j>. Net Position Gift Additions to September 1, 2012 Endowments Bill D. Francis Endowed Scholarship In Visual Art 29, William Wallace Woodside Endowed Presidential 34, Charles A. And Betti Friedel Saunders Endowed 34, Ben And Leota Gordon Endowed Presidential Scholarship 52, Coke Bryant Dilworth Endowed Presidential Scholarship 205, Sheila Rice, Ph.D. Endowed Scholarship For Academic 20, Dolores And Arthur C. Sands Endowed Presidential 60, , Nelson G. Patrick Endowed Scholarship In Music 59, , Robert Levers Endowed Graduate Scholarship In Studio 14, Bill And Mildred Dismukes Endowed Presidential 38, Ron J. Gieser Endowed Scholarship In Pharmacy 26, Austin Smiles Endowed Scholarship In Speech-Language 34, Elisa Costilla Endowed Scholarship In Education 29, Karl And Helen Mcginnis Endowed Presidential 133, Jens Jacobsen Memorial Endowed Scholarship In Nursing 17, Sara Burroughs Endowed Scholarship In Print 26, Henry Jungman Endowed Presidential Scholarship 46, Paul Reinhardt Endowed Scholarship In Design 16, St. David'S Health Care System Endowed Scholarship In 26, Randalls Endowed Presidential Scholarship In Pharmacy 51, Ruth And Myron Kuhlman Endowed Scholarship For 38, Bestor Scholarship 88, Jean Mckenzie Schenkkan Endowed Scholarship In 18, Elva J. Johnston Foundation Endowed Presidential 138, F. A. Matsen Endowed Presidential Fellowship In 132, June And Robert C. Pfullmann, Sr. Endowed Scholarship 33, T. C. And Grace T. Ho Scholarship 126, , Henry E. Heine Baumgarten Family Endowed 16, Robert 0. Walters Scholarship , Dr. Martin M. Crow Scholarship In Geoffrey Chaucer 136, Chlsa/Janie Villarreal Endowed Presidential 21, Scholarship In Dravidian Studies 86, Alan And Nancy Hamm Endowed Presidential Scholarship 47, , Billie Grace Herring Endowed Scholarship 20, , Opal A. Warden And Beatrice Shipman Memorial Endowed 80, Kerry And Nancy Merritt Endowed Scholarship 30, Margaret Dunlap Thompson Endowed Presidential 61, Mr. And Mrs. Scott L. Fordham Endowed Presidential 128, Joe Ed Manry Endowed Scholarship In Theatre Studies 14, Marvin Selig Endowed Presidential Scholarship In 122, The Corbin J. Robertson, Jr. Family Scholarship For 128, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ' , , , , , , , , , , , , , , , , , , , , , , , , , , ,956.19
124 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Nellie Mae Gilbert Memorial Endowed Presidential 90, Scott Fordham Endowment For Student Services 430, Edwin L. Pace Endowed Presidential Scholarship In 32, Ann Grabhorn Friday Endowed Presidential Fellowship 129, Charles W. And Judy Spence Tate Endowed Presidential 64, Donna And Jack S. Josey Endowed Presidential 33, Salome Mcallen Scanlan Endowed Graduate Fellowship In 64, Roxanne Williamson Endowed Scholarship 33, Mr. And Mrs. James H. Lee Endowed Presidential 32, Cclp Alumni Endowed Scholarship Fund 199, Stott Family Scholarship 57, Edward Morgan Case, Jr. And Rebecca Brown Case 127, William C. Perry Endowed Presidential Scholarship In 23, Tucker Family Endowed Presidential Scholarship 41, Dr. Arnold Romberg Endowed Scholarship Fund In 152, Silvie And Gary Crum Endowed Legacy Scholarship In 429, Ralph And Caroline Helmreich Endowed Presidential 164, Harry Crockett Baseball Scholarship 63, Harry Crockett Football Scholarship 63, S. K. Bhagat Endowed Graduate Fellowship In 67, Merrill Family Scholarship In The College Of Liberal 116, The University Co-Op Scholarship In Women'S Athletics 86, Patsy Stice Memorial Graduate Fellowship In Social 62, Wilbert W. Krause Endowed Scholarship 32, The Leslie Dyess Blanton Scholarship In The College 156, Sjoerd Steunebrink Scholarship Endowment 84, JackS. Gray, Jr. Endowed Presidential Scholarship 71, Charles E. Ragsdale Endowed Scholarship Fund 73, M. B. And Edna Zale Endowed Presidential Scholarship 63, Scott C. Simek Endowed Presidential Scholarship In 42, G. Jeanette Mcwilliams Endowed Scholarship 59, Heuer, George J., Jr. Ph.D. Endowed Graduate 1,092, Ted Freedman Endowed Scholarship 75, , Kappa Psi Pharmaceutical Fraternity Texas Graduate 102, David E. Campbell Endowed Scholarship In Engineering 17, Janelle And Henry Holman Endowed Presidential 71, Gaylord And Joann Endowed Presidential Scholarship 80, James E. Jim Nugent Family Endowed Scholarship Fund 88, Victor Szebehely Endowed Scholarship 35, Jesse H. Jones Endowed Scholarship In Engineering 266, Willie And Maurine Kocurek Endowed Scholarship 31, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 3, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,131, , , , , , , , , , , , , , , , , ,
125 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ ()) Marietta Moody Brooks Endowed Scholarship Fund In The Edmund Thornton Miller Endowed Presidential Gardner F. Marston Endowed History Scholarship Fund Coach Mack Brown Endowed Presidential Scholarship Sally Brown Endowed Scholarship In Weight And Coach Jeff Mad Dog Madden Endowed Scholarship In James E. Jim Nugent Family Endowed Scholarship Fund HaNey Penick Endowed Scholarship In Men'S Golf HaNey Penick Endowed Scholarships In Women'S Golf Aubrey C. Black Endowed Scholarship In Business Carol Chiles Ballard Endowed Presidential Scholarship Aly Khawaja Endowed Scholarship Jack Morgan Endowed Scholarship Lighthouse Drugstore Of Port Isabel Endowed David Deming Endowed Scholarship In Studio Art Joyce Whiting And M. Scott Kraemer Endowed John And Mary Booker Endowed Graduate Fellowship In Jean Welhausen Kaspar 100Th Anniversary Endowed Carolyn And John Elinger Endowed Presidential Martin L. Gibson, Jr. Endowed Scholarship In M. June And J. Virgil Waggoner Professorships In Kathryn And Beau Ross Graduate Fellowship Patricia Stephens Endowed Presidential Fellowship In Byars/Jordan Endowment For Mis Ira Lon Morgan Endowed Presidential Scholarship In Thomas M. Murray Scholarship Gatorade Scholarship Hascal S. And Mary B. Billingsley Golf Scholarship Anna Luiza Ozorio De Almeida Graduate Research William Eugene Mitchell Memorial Golf Scholarship Wilton E. And Catherine Thomas Endowed Scholarship Hays R. Warden Memorial Endowed Scholarship Jennifer Goodnight Maalouf And Nagy Wajih Maalouf James Edward Lee King Memorial Scholarship Teresa Lozano Long Endowed Scholarship Fund Teresa Lozano Long Endowed Graduate Fellowship Fund Lynn Wade Mccraw Endowed Presidential Fellowship George I. Sanchez Endowed Presidential Fellowship Joe R. Long Endowed Scholarship Fund Joe R. And Teresa Lozano Long Endowed Scholarship Joe R. And Teresa Lozano Long Endowed Chair In Net Position Gift Additions to September 1, 2012 Endowments 52, , , ,600, , , , , , , , , , , , , , , , , , ,874, , , , , , , , , , , , , , , , , , , '119, '119, , Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August31, , , , , , ,934, , , ' , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,940, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , '158, , '158, , ,220.37
126 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Homer Lindsey Bruce Endowed Graduate Fellowships in 4,130, Graduate Fellowship In Exploration Geophysics Cullen M. Crain Endowed Scholarship In Engineering Adrienne Hight Endowed Scholarship 20, ma Hogg Scholarship In Mental Health 385, Ut Lamp Margie Hale Endowed Presidential Scholarship 192, , Friends Of Alec Graduate Student Fellowship Fund 115, ,55Q A. P. Bradie Endowed Fellowship In Memory Of 104, Mary Miller Bartholow Endowed Presidential Fellowship 120, Wayne R. Barrington Endowed Scholarship In Horn 31, S. Allison Starr Pendergras Memorial Endowed 27, David And Lou Penticuff Memorial Endowed Book Fund In 15, Frederic And Julia Weigl Scholarship 48, Douglas Samuel And Amali Runyon Perkins Endowed 93, Richard Douglas And Judith Watson Perkins Endowed 115, Evan Frankel Fellowship In The Humanities 233, Scott Lind Daily Texan Journalism Excellence 55, Karen E. Woodside Endowed Presidential Scholarship In 65, Jack L. Thurber Memorial Endowed Presidential 337, , Carol And Jeffrey M. Heller Endowed Scholarship In 413, Carol And Jeffrey M. Heller Endowed Scholarship In 413, Irene Hoke Sandahl Endowed Scholarship For Physically 28, George Nokes Endowed Debate Scholarship Fund 46, Hank Chapman Endowed Scholarship In Swimming 67, Christoph Friederich Doscher Endowed Scholarship 328, Charles Paul Shearn Endowed Scholarship Lance Tatum Endowed Scholarship 28, Davila Family Endowed Scholarship In Pharmacy 161, , Carolyn Lewis Gallagher Endowed Presidential 518, Edward Sibley Lewis, M.D. Endowed Presidential 518, Annie Bell And Benjamin C. Watts Endowed Scholarship 52, Gary Hurford Friend Of Alec Endowed Scholarship In 121, Friends Of Alec International Student Scholarship 103, , Robert C. Solomon Endowed Scholarship In Plan li 344, , Halff Associates Inc. Endowed Scholarship In Civil 52, Departmental Visiting Committee General Endowed 27, Joe B. Hogsett Undergraduate Scholarship 109, Carrol Allen Teaching Fellowship In Civil Engineering 164, Christopher Benton Chadwick Memorial Endowed 356, Homer Lindsey Bruce Endowed Scholarship In Liberal 109, Homer Lindsey Bruce Endowed Graduate Fellowship Fund 1,385, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August :i1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~...
127 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ ~ 0> Net Position Gift Additions to September 1, 2012 Endowments Susan H. And Robert M. Campbell, Jr. Endowed 40, Robert E. Rimkus Endowed Presidential Scholarship In 80, , Martin Luther King, Jr. Endowed Presidential 44, sabelle T. '37 And H. Ben '36 Decherd Endowed 182, Sheldon Ekland-Oison Endowed Scholarship For Liberal 34, Eugene H. And Mary Duane Dawson Endowed Presidential 211, Texwood Furniture Corporation Endowed Scholarship 11 ' Mary Camille Kamie Ethridge Endowed Presidential 52, Bob And Lupe Egenolf Endowed Scholarship 28, Houston Endowed Scholarship In Art 27, Victor And Myra Ravel Law Scholarship In Children'S 84, Warren And Suzy Chancellor Endowed Scholarship 26, James C. Browne Graduate Fellowship 73, , George Fuisdale Jowett And Phyllis Frances Jowett 14, Kim Larson Holman Endowed Presidential Scholarship In 55, Thomas Henry Holman, Jr. Endowed Presidential 55, Neely Family Of Bellville Texas Endowed Scholarship 29, Maxine And Jack Zarrow Family K-16 Teaching 336, Mr. Jaroslav Stroleny And Mrs. Jindra Dagmar Stroleny 57, Graduate Fellowship In Honor Of Adoptive Parents 74, Robert H. Hamilton Endowed Graduate Fellowship 469, Wofford Denius Music Industry Internship Program 573, Sonia Wolf Wilson Endowed Scholarship 27, J. David And Jean Frank Endowed Scholarship 47, , Agnes T. And Charles F. Wiebusch Fellowships 263, Martha Ann Goss Mcgonigle Fellowship In Child 81, Charles Edwin Ed Smith, Jr. Endowed Presidentail 56, Margaretta Turpin Endowed Scholarhsip In Nursing 102, Victor L. Hand Endowed Scholarship Fund 199, Arlen L. And Betty K. Edgar Endowment For Excellence 57, Harry Perrin Family Endowed Scholarship 30, Paul William Bill Pitzer, Jr. And Nancy Darden 29, R. Steven Hicks Endowed Scholarship For Radio 54, Longhorn Football Endowed Scholarship 34, Betty L. Mccormick Memorial Endowed Scholarship In 28, John D. Curtis Endowed Graduate Fellowship In 174, W. C. And Lenora Smith Endowed Scholarship 60, Elizabeth L. And Russell F. Hallberg Foundation 60, Anna Saldana Endowed Scholarship In Law 12, Marathon Oil Company Scholarship 239, Rick Jay And Paula Myrick Short Endowed Graduate 60, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other AddiUons/ Deductions , Net Position August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,456.96
128 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Increase Investment (Decrease) in Fair Income (Realized Net Other Net Position Gift Additions to Investment Value of Gains and Additions/ Net Position September 1, 2012 Endowments Income Investments Losses) Deductions August 31, Nenetta Carter Tatum Endowed Presidential Scholarship 65, , , Clark C. And Ethel S. Gill Scholarship 1 72, , , Clark C. And Ethel S. Gill Scholarship 2 72, , , Clyde W. And Bonnie Patton Smith Endowed Presidential 236, , , John W. Jack Weitzel Endowed Memorial Scholarship 30, , , Arthur J Thaman And Wilhelmina Dare' Thaman Endowed 139, , , Duane Lee Moody Endowed Scholarship 33, , , Bonfire Unity Endowed Presidential Scholarship 57, , , James Howell Stuckey Scholarship In Marine Science 206, , , , Jane Harrell Pierce And Charles Curry Pierce, Jr 119, , , (43.58) , Jon And Becky Brumley Endowed Presidential 124, , , Ronald L. Ehrig Endowed Memorial Scholarship 30, , , Carolyn J. And John H. Young Endowed Presidential 117, , , Carolyn J. And John H. Young Endowed Presidential 117, , , Jack Seriff Endowed Presidential Scholarship In 57, , , Darrell K. Royal Endowed Golf Scholarship 61, , , Oak Grove Cooperative Undergraduate Scholarship 32, , , Endowed Memorial Scholarship For Indigent Orphans 137, , , Herb Kelleher Center For Entrepreneurship 8.469, , ,767, Michael Mizell Mankins Endowed Presidential 56, , , Dr. Fred Farias, Iii Endowed Scholarship In 28, , , , James Lawrence Fly Endowed Presidential Scholarship 69, , , Gerald And Linda Ridgely Endowed Presidential 118, , , Jeannette And Irving Goodfriend Educational Endowed 46, , , Masters-Sahraie Endowed Scholarship For Education 138, , , Jim Fenner Fund 74, , , Jennifer T. Barrett Undergraduate Scholarship In 30, , , Huckin-Liedtke-Lupton Family Endowed Presidential 119, , , George L. And Bonnie N. Kennedy Fund For Excellence 180, , , , Postdoctoral Fellows Endowment Ticam 6,027, , , ,264, Christopher P. Carothers And Michael M. Fleming 11, , John Edwin And Eleanor Bering Bailey Endowed 57, , , Cheryl And Robert Butler Endowed Scholarship In Art 58, , , Sonia And Javier Perez Scholarship In Journalism 73, , , Lawrence W. Speck Excellence Fund 319, , , Ted And Jan Roden Center Of Excellence In Engineering 1 '155, , ,195, Edith Freed Spivak Memorial Endowed Presidential 242, , , Thomas M. And Laura E. Suffield Fund For Excellence 30, , , L. C. Tubb, Jr. Endowed Presidential Scholarship In 71, , , Richard And Elizabeth Causey Endowed Presidential 135, , , ~ R. L. Folk/E. F. Mcbride Petrography Fund 93, , , (26.50) , ~ co
129 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ N 0 Net Position Gift Additions to September 1, 2012 Endowments William W. And Ruth F. Cooper Fellowship 617, Janet And Rocky Mountain Endowed Scholarship 66, South Austin Hospital Auxiliary Endowed Scholarship 60, , Boone Powell Family Prize In Urban Design 96, , Gaylord A. And Joann H. Jentz Men'S And Women'S 33, Pac Arts Education Endowment 104, Andersen Endowed Scholarship 30, Charles W. And Karen R. Matthews Endowed Scholarship 30, Betty And Ronald Spradlin Endowed Scholarship 31, John J. Mcketta Golden Eraser Endowed Scholarship 65, Henry And Bryna David Graduate Fellowship In Human 327, Carl Wayne Fleming Memorial Scholarship 30, Joshua S. Cannon Memorial Scholarship In Engineering 30, Marina P. Sifuentes Scholarship Endowment 64, , Xuan-Nguyen Huynh Endowed Scholarship In Liberal Arts 30, John L. Hern And Marilyn A. Hern Scholarship 69, Gregory George Shia Memorial Endowed Presidential 124, Fred J. And Jann H. Curry, Jr. Undergraduate 26, Irma Bates Batten And Robert Knox Batten Endowed 124, Tom Rousse/N. Edd Miller Debate Fund 57, Priscilla Pond Flawn Endowed Scholarship In Theatre And 34, Priscilla Pond Flawn Endowed Scholarship In Music 34, Raymond V. Cruce Endowed Scholarship Petroleum 203, John C. And Marian B. Maxwell Endowed Undergraduate 303, Orville Wendell O'Neal Memorial Endowed Scholarship 62, Brian Murray Welch Endowed Memorial Scholarship 36, Laura Brooks Flawn, M.D. Endowment Fund 131, Susan Adele Moore Endowed Book Fund 14, Carlene Kouba Behrens Memorial Endowed Presidential 127, Robert And Diana Ayers Endowed Presidential 124, R. B. And Margaret Lewis Endowed Presidential 486, Herbert F. Poyner, Jr. Endowed Presidential 124, William C. Race Endowed Presidential Scholarship In 143, , Jesse H. Jones Endowed Fellowship Fund 1,253, Burl H. Anderson Endowed Presidential Scholarship For 129, Ruth Patton Connor And Paul Dewitt Connor Endowed 62, Don R. Boyd Endowed Fund 164, , Abbie And Wales Madden, Jr. Endowed Scholarship 69, , Marsha And Wallace Fowler Endowed Undergraduate 35, RobertS. Braden Endowment 699, Robert A. And Donna Chereck Endowed Presidential 148, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 21, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions Net Position August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,297, , , , , , , ,174.63
130 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31,2013 Net Position Gift Additions to September 1, 2012 Endowments Tom And Nan Turner Endowed Excellence Fund In 36, Business Ethics Endowed Excellence Fund 261, Zandan Family Endowed Presidential Scholarship 126, Pearl Dubose Clark Endowed Presidential Scholarship 61, Faulkner Brothers Endowed Scholarship 351, , Jones And Carter, Inc. Endowed Presidential Scholarship 107, Nathalie Goodwin Memorial Endowed Presidential 218, M.S. And Meek Lane Doss Scholarship Endowment Fund 656, , Marcia Gay Harden Endowed Scholarship 30, James Morris Dial Endowed Scholarship In Actuarial 66, Bob And Mary Gude Endowed Scholarship In Pharmacy 125, Hill Bank And Trust Co. Endowed Educational Scholarship 302, Davidson Family Endowed Scholarship In Latin American 28, Jaime N. Delgado Endowed Graduate Fellowship In 148, , Elizabeth Warnock Fernea Excellence Endowment In Mary Hilliard Bickler- Max Hermann Bickler Memorial 59, Barbara M. Myers Endowed Scholarship In Liberal Arts 41, Thomas C. Mays Iii Endowed Scholarship 53, Milton And Lee Levit, Max And Rochelle Levit Endowed 30, Glenn Maloney Endowed Memorial Scholarship 24, Gareth Morgan Memorial Endowed Excellence Fund 63, Lee And Joe Jamail Endowed Scholarships In Secondary 627, Lee And Joe Jamail Endowed Presidential Scholarships Lee And Joe Jamail Endowed Presidential Scholarships 313, Jaime N. Delgado Endowed Scholarship 26, Celia Davila Delgado Endowed Scholarship 26, Girling Health Care Undergraduate Scholarship In 30, Jastrow/Thomas Endowed Presidential Scholarship 93, Phyllis Benson Roberts Endowed Presidential 82, Houston Chapter Gas Processors Association Endowed 52, Mary Ann Dingman Memorial Endowed Scholarship 157, James Scranton Peevey, Clu Endowed Memorial 31, The Paul Pierre Standifer Endowed Scholarship In Film 25, Arthur E. Maxwell Graduate Fellowship In Geophysics 152, Robert N. Little Graduate Fellowship In Physics 317, , Jerome And Sylvia Wilkenfeld Endowed Plan li 34, Louis A. Zurcher Memorial Scholarship 14, Nancy Leona Dry Smith Hopkins Endowed Presidential 71, Amado M. Pena, Sr. Endowed Scholarship In The 108, Dr. Norman Hackerman Endowed Scholarship In Chemistry 36, Joan W. And J. Cecil Rhodes Endowed Presidential 69, Net Increase Investment (Decrease) In Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Dedudions August 31,2013 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , N 2, ,
131 ~ The University of Texas at Austin N Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Increase Investment (Decrease) in Fair Income (Realized Net Other Net Position Gift Additions to Investment Value of Gains and Additions/ Net Position September 1, 2012 Endowments Income Investments Losses) Deductions August 31, Gail Chenoweth Endowed Scholarship In Petroleum 50, , , Crees Student Exchange Endowment 63, , , , Willa Stewart Setseck Scholarship 256, , , Robert Divine Graduate Research Endowment 110, , , Paul And Tish Szurek Endowed Presidential Scholarship 142, , , Eugene R. Fant Endowed Scholarship Fund 582, , , Cynthia G. Nut! And James N. Nutt, Jr. Endowed 53, , , Chemistry And Biochemistry Authors' Scholarship 68, , , , Wiethorn Family Endowed Presidential Scholarship 62, , , Walter B. Smith, Jr. Undergraduate Scholarship Fund 3,204, , ,317, Edward J. Perrault Endowed Presidential Scholarship 69, , , Bank One Endowed Scholarship 500, , , Arthur H. Carter Scholarship Fund 650, , , Janet Spence Endowed Fund In Psychology 44, , , JohnS. Rudd Jr. Endowed Scholarship In Actuarial 61, , , Dr. David Otto Nilsson Student Support Endowment 34, , , Lala Fay And Claude Devan Watts Endowed Presidential 270, , , Fred Holmsley Moore Chair In International Management 1,331 ' , ,377, Hugo Leipziger-Pearce Endowed Graduate Fellowship In 121, , , The David L. Shull Memorial Scholarship 66, , , Schering-Piough Research Institute Graduate 66, , , Moni Pula/Baker Hughes, Inc. Endowed Scholarship In 638, , , John A. Gronouski 30Th Anniversary Endowed Graduate 71, , , Alfonso And Dora Gonzales Endowed Presidential 56, , , Nancy And Marc Bedford Endowed Undergraduate 34, , , Orrin Hopper Engineering Scholarship 280, , , Karen D. Hagedorn Endowment 28, , David A. Ott, M.D. Endowed Scholarship 34, , , Kay Pearson Harrison Endowed Presidential Scholarship 90, , , John T. Files Endowed Scholarship In Engineering 63, , , Pejaver Shridhara And Janaki Rao Endowed Scholarship In 29, , , Bill And Mary Etta Moreau Endowed Presidential 67, , , , Frances Brannen Vick Endowed Presidential Scholarship 63, , , Ross W. Vick, Jr. Endowed Presidential Scholarship In 63, , , Roy And Lillian Bedichek Scholarship In English 31, , , Martin Parmer Scholarship In Texas History 33, , , Charles Nesbitt Wilson Scholarship For International / 36, , , Flemingff ejas Scholarship 63, , , Jerry F. Priddy Endowed Scholarhsip 31, , , Lillian C. Ho Endowed Presidential Scholarship 144, , , , Professor Bruce D. Smith Memorial Scholarship 101, , ,924.66
132 Schedule B-Ga Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Anne Pardonner Endowed Scholarship For Athletics 30, John A. Woody Woodman Endowed Baseball Scholarship 132, Maxine And Jack Zarrow Scholarship For Future 60, Mcilhany Endowed Presidential Fellowship 121, Audrey And Sheldon Davis Endowed Presidential 113, The Doctors Jean And Richard Holt Scholarship In 28, Dennis A. Anderson Endowed Presidential Scholarship 124, Cedora Naderson Endowed Presidential Scholarship 124, Overland Partners Endowed Scholarship 47, , Glen C. And Jeanne D. Moore Endowed Scholarship 29, Fort Worth Wildcatters Association Undergraduate 34, Sam Attlesey Endowed Scholarship Fund 176, Ivy Mcquiddy Endowed Scholarship For Study Abroad 29, Cogburn Foundation Philosophical Prize 99, Craig A. And Denise W. Dubow Endowed Presidential 57, R. Graham Whaling Endowed Scholarship In Petroleum 216, The Melanie Walter-Mahoney Endowed Scholarship In 28, Merner Endowed Scholarship In Liberal Arts 486, Thomas And Elizabeth Merner Scholarship In Natural 486, Luise S. Champion Memorial Scholarship Fund 427, Sarah And Ernest Butler Family Fund Endowed 187, William And Bettye Nowlin Endowed Presidential 226, Florence Nightingale Memorial Scholarship 29, Margaret Alexander Steiner Endowed Scholarship Fund 116, Sara Martinez Tucker Endowed Scholarship 29, Sarah And Ernest Butler Family Fund Endowed 188, Herbert And Johanna Liebscher Foundation Endowed 310, , Hanyang University Excellence Endowment In Student 1,099, Clyde Copus And Nash Phillips Endowed Scholarship 58, Gregory Dalton Drago Spirit Of Life Endowed 57, , Greater Texas Foundation Endowed Scholarship 87, Lillie S. Matthews Endowed Scholarship 699, B. Berard Matthews Endowed Scholarship 716, Dorothy Ayres Endowed Scholarship 699, Mary Alice Davis Women'S Basketball Endowed 34, Samuel Adam Prinz Memorial Endowed Scholarship 51, Texas Endowed Scholarship In Music 56, Rita T. And J. Crozier Brown Endowed Graduate 55, Edward Triggs Endowed Scholarship In Design 17, , Harry And Rubye Gaston Endowed Scholarship 206, Wiethorn Family Endowed Presidential Scholarship In 49, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , '137, , , , , , , , , , , , , , , , , , , , , , , , N 1, , (..)
133 '- The University of Texas at Austin Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, N """ Net Position Gift Additions to September 1, 2012 Endowments Robert M. And Susan H. Campbell Endowed Scholarship 27, Aep Power Systems Engineering Scholarship In Honor Of 166, , Joe D. Ligon Endowed Scholarship In Engineering 58, W. A. Tex Moncrief, Jr. Chair In Computational 2,270, Lawrence A. Fuess Endowed Presidential Scholarship In 51, , Dock Williamson Loll And Loise Mcdonald Lott 336, J. M. And Florence Matthews Endowed Presidential 104, Irwin Spear Memorial Scholarship In Plan li 98, , Urban Edge Developers Endowed Scholarship In 24, Neva Mcmurry Riedel Scholarship In Journalism 35, Kathy And Philip Patman Endowed Scholarship In 27, William F. Powers Endowed Scholarship In Engineering 97, David L. Miller And Mary H. Miller Graduate 1 '143, Cogburn Family Foundation Architecture And Urbanism 94, Professor Robert L. Van Dusen Endowment 266, Theodore H. Strauss Endowed Scholarship For Civic Damon P. Smith Iii Endowed Scholarship 1,245, , Helen B. Green Endowed Undergraduate Scholarship In 33, Fred J. And Jann Curry Endowed Scholarship 27, Kenneth M. Jastrow li Endowed Scholarship 1,200, Peter And Eva Riley Graduate Fellowship In Physics 69, Louise J. Faurot Memorial Endowed Fellowship In 53, Louise J. Faurot Memorial Endowed Presidential 53, Dr. H. Franklin Alexander Endowed Scholarship 23, Dr. David Otto Nilsson Endowed Presidential 52, Danielle J. Martin Memorial Scholarship 37, Barbara Tecla Heinzkill Sabo Endowed Scholarship 37, Louis T. And Jewell K. Pirkey Endowed Scholarship 101, Harold N. And Dorothy B. Walsdorf Endowed 56, Mark And Patricia Moores Endowed Presidential 69, , Fleming Fellowship Scholarship 103, Craig A. And Denise W. Dubow Endowed Presidential 54, Carmel ina Cutro Albino Memorial Endowed Presidential 83, James A. Gibbs Hydrogeology And Engineering Geology 175, Dr. Carl Erving Adams, Jr. Endowed Presidential 52, Gwyn A. David Longhorn Life Endowment 85, Faegheh Fawn And Vijay Mahajan Teaching Excellence 55, Reed Rock Bit Company Endowed Presidential 47, W. 0. Roberson Endowed Scholarship 19, Herbert And Darlyn Jung And Elroy And Gail Tschirhart 26, F. Michael Wood Endowed Presidential Scholarship 62, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , , , Net Position August 31, , , , ,356, , , , , , , , , '183, , , , ,295, , , ,242, , , , , , , , , , , , , , , , , , , , ,831.31
134 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments James R. Moffett Scholarship Fund 30, Milton E. Schoeman Endowed Excellence Fund In 16, , Chuck And Dana Farmer Excellence Fund In Petroleum 193, , The Cba/AIIen H. Bizzell Endowed Scholarship 43, Fred W. And Laura Weir Clarke Endowed Presidential 46, Fred W. And Laura Weir Clarke Endowed Presidential Thomas And Marty Godbout Endowed Scholarship In 25, Harris Berry Grubbs Endowed Scholarship In Civil 28, Howard F. Rase Endowed Presidential Scholarship 50, Elaine V. Declerck Endowed Scholarship For The 43, Judge James Benjamin Clark Endowed Scholarship In 27, Robert And Kristin Gauntt Endowed Scholarship 103, Dick Rothwell Endowed Scholarship 498, , Buster And Ada Mae Baebel Endowed Scholarship 25, Greg Prewoznik Endowed Graduate Fellowship 54, Elizabeth Sherrell Endowed Scholarship 26, Shannon Mcguire Memorial Scholarship 49, Dorothea Bachemin Dishongh Smith Endowed Scholarship 24, Christopher Williams-Susan Dillon Journalism 22, Dr. Robert J. Wills Graduate Fellowship Endowment 85, , Bill And Ann Stokes Endowed Scholarship 93, Kyle Hilliard Endowed Presidential Scholarship 49, Harry Kent Endowed Presidential Scholarship In 177, , S. Paul Mitchell And Toby Mitchell Scholarship In 25, Nella Skinner Petrick And Thomas W. Petrick Endowed 39, , Robbie And Roy Sorenson Endowed Electrical 309, Glickman Graduate Fellowship In Early Childhood 49, Charles And Dorothy Mad din Endowed Scholarship In 45, The Resendiz Family Endowed Scholarship 26, Mark And Chrystine Roberts Endowed Scholarship 94, , C. Stephen And Patricia W. Saunders Endowed 24, Thomas W. Dison Endowed Scholarship 63, , John 0. Smith- Houston Livestock Show And Rodeo Tm 99, Judith Wells Lindfors Endowed Graduate Fellowship In 49, Mr. And Mrs. William H. Hildebrand Scholarship Fund 840, Butler Opera Center Endowed Presidential Scholarship 185, Judge Royce C. Lamberth/Tejas Scholarship 49, Diana And Todd Maclin Endowed Excellence Fund In 284, , Bruce Fuller, Jr. Endowed Presidential Scholarship In 56, , Charles C. And Lula May Wilson Endowed Scholarship 2,786, Newman Foundation Endowed Graduate Fellowship 49, Net Increase Investment (Decrease) In Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~ 97, ,884, N 1, ,
135 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August31, 2013 (J) "' Net Position Gift Additions to September 1, 2012 Endowments Baker Hughes Undergraduate Scholarship Endowment Fund 49, Nancy And Allen Locklin Endowed Scholarship In 42, Butler Opera Center Endowed Presidential Scholarship 184, Roman Family Endowed Scholarship 102, Lynn And Irvin Wall Endowed Presidential Scholarship 75, Malcolm Milburn Endowed Scholarship And Award In 73, Denver L. And Jackie L. Mills Endowed Scholarship For 25, Warren R. And Yvonne B. Waggoner Endowed Scholarship 70, , Tartan And Naomie Collier Endowed Engineering 29, Keyes Family Endowed Scholarship Fund 52, Margie Gurley Seay Endowed Presidential Scholarship 31, Alec Frank Beck Endowed Scholarship 672, Norman B. Oshman Endowed Memorial Scholarship In The 50, , AI F. Tasch, Jr. Memorial EndOWed Graduate Fellowship 49, American Pharmacies Fellowship In Independent 93, Frank Ludwig Weisser Memorial Endowed Presidential 50, Matthew Purdy Endowed Scholarship In Engineering 24, William H. Luedecke Endowed Undergraduate Scholarship 110, Kirk And Jean Pipkin Endowed Scholarship In 48, , Judge Harley Clark/Tejas Scholarship 52, Mrs. George Routh Felter Endowed Scholarship For 96, Georgia Felter And Carey Legett, Jr. Dean'S Endowed 96, John Greene Taylor Family Graduate Fellowship In 51, Wofford Den ius Ut In La Scholarship Endowment 458, The Willie Tichenor Scholarship In Plan li 172, Randall And Dewey Leadership Award Honoring Ken Dewey 46, Lane Smith Memorial Scholarship 23, Charles And Barbara Peck Endowed Scholarship 23, David L. Chen Endowed Study Abroad Scholarship In 76, , A mit Garg Graduate Fellowship In Computer Science 27, Hamermesh Senior Thesis Prize In Economics 27, Academy Of Distinguished Graduates Endowed 138, , Texas Blazers Endowed Scholarship 28, , Ernie Hodge Scholarship Fund 23, Dr. Lee-Hsia Hsu Ting Endowed Graduate Fellowship In 46, Tyrrell E. Flawn Graduate Fellowship In Nutrition 112, Hdr Architecture Endowed Scholarship 25, Professor John C. Gilbert Endowed Scholarship In 29, J.D. And V. L. Langston Endowed Scholarship Fund In 445, Richard S. Barfield Endowed Scholarship 22, Dr. Fumiko Tamura Graduate Fellowship In Foreign 94, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , ' Net Position August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,349.33
136 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than Stale As of August31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Richard D. Trubitt Family Endowed Scholarship 161, , Michael Kapoulas Endowed Scholarship Composition 26, Julie Hallmark Honorary Graduate Fellowship 52, Peter Vlach Memorial Scholarship In Liberal Arts 27, Lucy Ella Stead Memorial Endowed Scholarship 21, John H. Runge Endowed Scholarship 27, Richard And Janis Lariviere Graduate Fellowship In 94, Dr. Ariane L. Beck And Mr. Eric Sebesta Endowed 25, D. J. Sibley Family Centennial Faculty Fellowship In 378, Mark R. And Renee W. Lange Endowed Scholarship 98, Kevin And Lori Chase Endowed Scholarship 103, Christopher S. Beach Endowed Scholarship 97, George W. Moore Jr. Endowed Scholarship In Business 225, Ruth Middleton Valentine Endowed Presidential 46, Gino R. Narboni Endowed Presidential Scholarship In 46, John A. Weinzierl Endowed Presidential Scholarship In 98, Phil Schmidt Honorary Endowed Scholarship In 23, Will Sarosdy Endowed Scholarship In Swimming 58, Texas Pharmacy Foundation Scholarship 23, Jaclyn Suzanne Randall Endowed Scholarship In 46, Helen And Mark J. Brannon, Jr. Endowed Scholarship In 43, Maxine And Jack Zarrow Family Foundation Scholarship 100, Katherine Hubby Weiner And Stephen P. Weiner Endowed 156, David Rosenberg Scholarship 17, Henry Weiss Scholarship 17, John E. Breen Endowed Presidential Fellowship In 129, Mba Class Of 2006/David Lee Chen Memorial Graduate 116, , Louis P. Randall Endowed Scholarship In Engineering 46, William B. And Sara G. Hilgers Endowed Scholarship In 21, Dan And Peggy Pitts Endowed Scholarship 100, George And Vickie Bayoud Ethics In Government 21, Arch Campbell Scholarship For Creative Vision 31, Jack And Ginger Blanton Endowed Presidential 104, Maria And Pablo Torres Memorial Scholarship For 26, Sue Surbey Shoemake Endowed Scholarship 96, Ralph C. And Sally P. Duchin Student Field 98, , Wagner Scholarship 44, Terrence And Mary Claire Welch Undergraduate 68, , Les And Sherri Stu ewer Endowed Scholarship In 225, , Thomas A. Sullivan Endowed Presidential Scholarship 194, Louden Endowment Scholarship 33, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , >. N 1 ' ,
137 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, 2013 _.. (X) "' Net Position Gift Additions to September 1, 2012 Endowments Plan li Study Abroad Endowment 79, Chesley And Florence Hill Boyd Endowment 65, Laurens Pratt Endowed Scholarship In Mechanical 21, Roberta Chaudoin Snavely Endowed Scholarship 25, Robert G. And Eleanor Crowder Bjoring Scholarship 87, Pete Allen Scholarship 53, Dean Byron Fullerton/Tejas Scholarship 43, Judge Zeke Zbranek!Tejas Scholarship 43, Toribio Tienda Memorial Scholarship 27, , Dorothy Jean Krueger Graduate Fellowship In The 56, Robert N. Hudspeth, Jr. Scholarship 21, Josefina Lesvia Falcon Undergraduate Scholarship Fund Josefina Lesvia Falcon Graduate Fellowship Fund 156, William F. Mccombs Scholarship In Aerospace 169, Mom'S Pharmacy Scholarship Honoring Elena, Veronica, 21, Carlota S. Smith Memorial Fellowship 157, C. Thomas Behrman/Tejas Scholarship 42, John F. And Rebecca Petersen Luman Endowed 25, , Undergraduate Scholarship To Support Geosciences 407, College Of Natural Sciences Dean'S Scholars Honors 403, Dr. David Nancarrow Scholarship In Theatre And Dance 25, Dianne And Leslie White Endowed Scholarship 48, Thomas C. Mays Iii Endowed Scholarship 96, Hunt Petroleum Field Camp Scholarship Fund 22, Dr. Carl E. Adams, Jr. Endowed Presidential 47, Irene Zercher St. Clair Endowed Presidential 144, Susan K. And Warren Jack Cage Endowed Scholarship 57, , Ut Scouting Award Scholarship 87, Raymond E. Davis Endowed Scholarship In Chemistry And 30, , Dr. Byron P. Leonard Memorial Endowed Presidential 102, Dallas Advisory Council Scholarship In Art And Art 43, Maline Mary Ailine Gilbert Mccalla Scholarship 44, , Robert H. Graham Endowed Scholarship In Engineering 69, Dr. Bill And Jill Williams And Dr. Jim And Kitty 106, Amos Salvador Stratigraphy Scholarship Endowment 220, Joan F. Curry Endowed Presidential Scholarship 409, Gregory E. Lucia/Tejas Scholarship 45, Michael Kuhn Endowed Presidential Scholarship In Plan 62, , Otto Harrison Endowed Scholarship In Petroleum 50, , J. M. White Graduate Fellowship In Chemistry 124, Thomas E. Adn Anna J. Fanning Undergraduate Honors 97, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 2, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions! Deductions , , Net Position August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,224.72
138 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Professor Wolfgang F. Michael Graduate Fellowship 1,074, Architexas Endowed Schola~~>hip 25, Kenneth B. And Jane Stroud Ford Endowed Scholarships 50, Doc Sellers Endowed Presidential Scholarship For 456, Raymond Estep Endowed Presidential Fellowship In 55, Raymond Estep Endowed Presidential Fellowship In 55, A.J. And Pat Welch Endowed Graduate Fellowship Fund 92, , Turing Honors Scholarship 104, , Amy Dryden Endowed Scholarship 21, Janey Katherine Marmion Endowed Presidential 91, Ardis M. Rewerts Scholarship Endowment 66, The Corinne And Toby Carleton Scholarship Endowment 58, Leslie Fallon And Carter Copeland Scholarship In 28, Professor Stanley N. Werbow Memorial Scholarship In 21, Gerald E. Hawxhurst And Susan St. Denis Endowed 31, , Norman Hackerman Prize For Undergraduate And Graduate 42, Hilary And Scott Hill Endowed Presidential 43, Danny Dinges Endowed Scholarship In Engineering 21, Elmer L. Hixson Endowed Graduate Fellowship In 54, , Irene Hoke Sandahl Endowed Scholarship For Physically 30, Charles Sandahl, Jr. Endowed Scholarship For 78, Jack W. Arlit! Endowed Scholarship In Engineering 21, Frederic D. Weinstein Memorial Fellowship In 108, Barbara And Donald Pender Endowed Scholarship 26, James W. Edwards And Nancy T. Snyder Memorial 31, John C. And Carol L. Heideman Endowed Scholarship In 96, Matthew Olim Endowed Scholarship 103, Tucker Hudson Kumar Endowed Presidential Fellowship 112, Nick Finnegan Scholarship Endowment 205, Danny Toole Memorial Turing Scholarship 36, Fred And Jann Curry Endowed Scholarship Fund 76, , Arthur Rauch - Phi Kappa Psi Endowed Scholarship Fund 245, Dr. Feng Zhang And Dr. James Mcginity Graduate Fellowship 48, Patricia L. Johnston Endowed Fellowship In Biological Sciences 97, , John And Virginia Gidley Endowed Scholarship In Chemical Engineering 41, , RobertS. Harvill, Jr. Endowed Scholarship 23, Holly S. Goodrich Endowed Undergraduate Scholarship 22, , Todd And Dawn Aaron Endowed Presidentialscholarship In Jewish Studies 51, George Sedberry Monkhouse Endowed Scholarship In Petroleum Engineeri 55, John Robert Monkhouse Endowed Scholarship In Electrical Engineering 55, Carolyn A. And William B. Holland Scholar To Support Geosci Students 58, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , ,111, , , , , , , , , , , , , , , , , , "16 69, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~ 1, , , ,15 60, "' co
139 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than Stale As of August31, 2013 ~ w 0 Net Position Gift Additions to September 1, 2012 Endowments Leo Daniel Foundation Endowed Scholarship 76, , Alan Scott Scholarship 28, , Lola Rea Wilkinson Scholarship Fund 576, William Harold Whited Endowed Scholarship For Plan li Students 37, Greater Texas Foundation Endowed Scholarship In Geosciences: Removin 109, Jeff And Gail Kodosky Uteach Physics Teacher Scholarship 74, Michiro Naito Endowed Fellowship In Physics 46, Jennifer A. Kemp Memorial Scholarship In Accounting 102, , Darrell D. Rocha Scholarship In Communication 40, Thomas & Patricia Moore Endowed Scholarship 82, Bary Hutsell Engineering Scholarship 73, Bary Hutsell Athletics Scholarship 73, Bary Hutsell Endowed Scholarship 73, Susan Stoltz Tirey Memorial Endowed Presidential Scholarship 45, Jayne Noble Suhler Endowed Scholarship in Plan II Honors 56, Boudreaux Endowed Scholarship in Nursing 27, Hyman Joseph Ettlinger Fund for Mathematics Students 31, Ronald Deford Technical Session Award 59, , Dean's Endowed Excellence Fund 885, , Karen & Charles Matthews Endowed Presidential Fellowship in Nutrution 89, , Shannon Neville Houghton Scholarship 39, , Alpha Epsilon Delta Memorial Scholarship 43, Ash ely & Rad Weavver Endowed Scholarship 166, , Mildred & Charles Albert Stead, Jr. Endowed Scholarship 27, Emma & Charles Albert Stead, Sr. Endowed Scholarship 33, Dr. H. Franklyn Alexander Endowed Fellowship 42, , Greater Texas Found Endowed Scholarship in Engineering: Removing Ed 122, Vivek & Pooja Shah Endowed Scholarship 23, , Colt Coble Birdwell Endowed Presidentials Scholarship 68, Joy & Morin Scott/Sally & John Byram Graduate Fellowship 299, Kenneth Ford Family Endowed Scholarship 33, , Bill & Tomiko Kennedy Memorial Endowed Presidential Scholarship 61, Rogerio Cruz Garza Memorial Endowed Scholarship in Civil Engineering 13, Charles Elliott Byrd Graduate Fellowship Philosophy 54, Hilda B. Cavell Memorial Endowed Scholarship in Nursing 89, Garth Bates Jr. Memorial Endowed Presidential Scholarship in Business 100, Sally Seale & A. E. Chionsini Endowed Scholarship in Chemical Engineering 56, , Sylvie & Gary Crum Endowed Scholarship Cynthia Lubocki Riley Memorial Scholarship in Nursing 804, Steven & Alexandra Cocavessis Endowed Scholarship in Nursing 27, Division of Recreational Sports Endowed Scholarship 34, Net Increase Investment (Decrease) In Fair Income (Realized Investment Value of Gains and Income Investments Losses) 2, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions 14, , , , Net Position August 31, , , , , , , , , , , , , , , , , , , '121, , , , , , , , , , , , , , , , , , , , , , ,402.88
140 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments David Austin Endowed Excellence Fund 56, , Bob Schenkkan Endowed Presidential Scholarship 87, , Jane & Mike Downer Graduate Fellowhip in Physics in Memory of Glenn Br 194, , Fay Evans Martin & Stephen Martin Endowment 69, Sondra Lomax Endowed Scholarship in Dance 23, , Vincent J. Dinitto Endowed Scholarship 27, , Matthew Kreisle Ill/Page Southerland Page Graduate Fellowship in Architec 66, C. William Brubaker/Perkins+Will Endowed Presidential Scholarship 61, Erin Koechel & Jeff Duchin Endowed Scholarship 42, , JK Aggarwal Endowed Pres Scholarship in Electrical & Computer Engineeri 132, , Meredith & Langston Turner Endowed Scholarship 41, , Virginia Lipscomb Curtain Club Endowed Scholarship 29, , Yates Memorial Endowment- Gradutate Petroleum Engineering 1,060, Daniel Read Fortson Endowed Scholarship in Engineering 31, Myrtle & George Isensee Scholarship Endowment 16, Lois K. Folger Endowed Scholarship in Petroleum Engineering 32, Ann & Henry Hamman Scholarship in Geosciences 66, Lynne Brundrett Maddox Scholarship in Interior Design 37, Hock & Lucille Knoche Butcher Endowed Scholarship 37, Betty Ann Willmann Smith Endowed Scholarship 31, Leigh Family Endowed Graduate Fellowhip in Mechanical Engineering 104, , Wilmont Vickrey Endowed Scholarship 27, Greater Texas Foundation Endowed Scholarship for UTeach 198, Dusky Chionsini Waters Endowed Scholarship in Nursing 57, Mary Ann & DeLoss Dodds Scholarship 138, Provenance Consulting Endowed Scholarship in Chemical Engineering 34, , Ford, Powell & Carson Endowed Scholarship 26, Brian & Julia Landrum Endowed Scholarship 53, Joe & Teresa Lozano Long Piano Scholarship 603, Stephen McDonald, PH.D. Endowed Fellowship in Economics 463, , Alii en & Paul Davidson Scholarship Fund for the University of Texas at Aust 283, Alison Davis-Blake Endowed Scholarship 17, Sixth River Architects Endowed Fellowship 48, , Eric & Deborah Gonzales Endowed Presidential Scholarship in Engineering 96, , Steve & Jane MacFarland Endowed Scholarship in Engineering 29, Dr. Alberto G. Garcia Scholarship 109, Lois Johnson White Endowed Presidential Scholarship 50, , Potter Rose Graduate Fellowship 529, Richard Dulin Memorial ENdowed Scholarship 32, Timothy Taylor Endowed Scholarship in Petroleum Engineering 42, Joe & Teresa Lozano Long Graduate Fellowship Fund 603, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 1, , , , , ,055.Q1 243, , , , , , , , , , , , , , , , , , , , ,097, , , , ' , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~ 21 ' , ~
141 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ (..) N Net Increase Investment (Decrease) In Fair Income (Realized Net Other Net Position Gift Additions to Investment Value of Gains and Additions/ Net Position September 1, 2012 Endowments Income Investments Losses) Deductions August 31, Z.D. Bonner Endowed Presidential Scholarship in Chemical Engineering 60, , Dave Tait Memorial ENdowed Scholarship in Softball 29, , , Sidney & Pearl Hotchkiss Endowed Scholarship 14, , , Sara Martinez Tucker Endowed Fellowship , , , Boyce Family Scholarship 22, , , Texas Chapter American Society of Landscape Arch Endowed Graduate Fe 55, , , Sarah & leo Horvitz Endowed Scholarship Fund 31, , , Margaret Surratt Endowed Scholarhip in Communication Studies 47, , , Thomas & Harriet Murray Endowed Scholarship in Engineering 26, , Merril A. Lowe Endowed Scholarship In Civil Engineering 22, , , Mark Hart, Jr. Endowed Scholarship 191, , , Lena & Marc Malacoff Scholarhip in Pharmacy 21, , , John & Kelli Weinzierl Endowed Pres Fellowhsip in Pet & Geosystems Eng 243, , , , Richard Davis Endowed Scholarship 26, , Kelly & Pat Frost Endowed Scholarship in Business 16, , , Spence & Nance Endowment 29, , , George Torres Endowed Graduate Fellowhip 51, , , , Georgina Goodnight End Schol in Chem Engineering 22, , , Molly Lamphear Endowed Scholarhip 28, , , Elizabeth Maret Endowment 552, , , John Curry Endowed Presidential Scholarship 404, , , Patricia & Charles Rentschler Endowed Presidential Scholarship 41, , ,967.99, Judy Dunn Memorial Endowment in Women's Athletics 28, , , Peter Tsan Endowed Scholarship 38, , , (5,174.04) 41, Steve Barton Endowed Presidential Scholarship in Piano 111, , , Nicholas Cominos fund 35, , , Mr. & Mrs. Robert Kern, Jr. Memorial Endowed Scholarhip in Law 17, , , Academy of Dis! Grads Endowed Grad Fship in Civil, Arch, & Env Engineer 101, , , , Hazel M. Pipkin Scholarship in Pharmacy 33, , , , Robin & John Wombwell Endowed Presidential Fellowhip 114, , , Donald and Charlotte Knaub Endowed Scholarship in Trombone 30, , , , Paul J. Szaniszlo Endowed Scholarship 32, , , , Michelle Brock and Sophia and G.W. Brock Endowed Pres Schol in Plan II 108, , , Robert & Ann Timmins Endowed Scholarship in Chemical Engineering 135, , , Pat Hedgecoxe Endowed Scholarship in Aerospace Eng & Eng Mechanics 28, , , Jean & Bill Booziotis Endowed Graduate Felllowship in Architectural History 47, , , , Steve Grosskopf Endowed Scholarship in Studio Art 24, , , Lawrence Speck Endowed Graduate Fellowship 54, , , , Carl Robert Kahmer Endowed Scholarship in Chemical Eng 33, , , (42.43) , Julie Mclemore Endowed Book Fund 15, , The UT Austin School of Architecture's Advisory Council Women's End Sch 20, , ,847.75
142 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012' Endowments George & Peggy Madden Endowed Scholarship in Engineering 59, Albert Gillis Endowed Scholarhsip in Strings 55, Suzanne & John McFarlane Endowed Scholarship in Winds 53, Suzanne & John McFarlane Endowed Scholarship in Vocal & Choral Arts 53, Suzan Glickman Endowed Fellowship in Learning Disabilities 54, Suzan Glickman Endowed Fellowship in Early Childhood Special Ed 54, Scott Chamberlain Memorial Endowed Presidential Scholarhip 54, J. Scott Mattei Endowed MBA Scholarship 61, , Delta Tau Delta Endowed Scholarship 27, Reinsborough Unctergrad Recruiting Excellence Scholarship 6, Ward & Sara Widener Endowed Scholarship in Music 53, Ralph Cutler Greene Endowment 53, John & Suzanne Shore Endowed Presidential Scholarship in Music 107, Brook Boynton Endowed Presidential Scholarship 141, Faculty Endowed Scholarship in Music 56, Wesley Calhoun, Jr. Endowed Scholarship 1 '128, Suzie Friedkin Endowed Scholarship in Interior Design 36, Eli Cox Honorary Scholarship in the Business Honors Program 81, , Shirley & Frank Zachry Endowed Presidential Scholarship in Music 53, Mary E. Sherrill Endowed Presidential Scholarship in Music 107, Dennis & Patricia Sharp Endowed Scholarship in Engineering 15, , Barney & Linda Knight Endowed Scholarship 53, Orlando Zayas Scholarship in Business 102, David & Evelyn Lancaster Friends of Alec Endowed Scholarship 60, , Warren & Alice Meyer Endowed Scholarship in Engineering 895, Acacia Fraternity Endowed Scholarship 28, Brien & Ripperda Family Endowed Presidential Scholarship 104, Edgar Family Endowed Scholarship 19, , Tod & Tracy Hammond Endowed Presidential Scholarship 104, Dr. Janet Hauber Endowed Presidential Scholarship in Engineering 53, Platt, Sparks & Assoc Consulting Petroleum Eng Sch in Pet Engineering 53, Robert Taylor Endowed Presidential Fellowship 107, Linnet Deily Endowed Presidential Scholarship 101, , Ray & Denise Nixon 40 Acres Scholarship in Business 529, Myron Blalock Endowed Presidential Scholarship 20, , Charles Rogers Friends of Alec Endowed Scholarship in Mechanical Engin 15, , Robert Canik Family Scholarhip in Engineering 17, , Manzano and Ybarra Endowed Presidential Schol for Bilingual Students 513, Jon Meacham Scholarship in Journalism 27, Timothy Baker Endowed Scholarship in Marine and Freshwater Biology 15, , Janet and David Rainey Geoforce Texas Scholarship 15, , Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31,2013 2, ' , , , , , , (56,287.64) 1, , , , , , , , , , , , , , , , , , , , , '167, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~ , , w
143 -" 0) Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013.j>. Net Increase Investment (Decrease) in Fair Income (Realized Net Other Net Position Gift Additions to Investment Value of Gains and Additions/ Net Position September 1, 2012 Endowments Income Investments Losses) Deductions August 31, Susan & David Humiston Endowed Scholarship in Education 26, , Michael & Elizabeth Cotton Endowed Presidential Scholarship 30, , , , Marie & Bill Ashby Endowed Presidential Scholarship in Plan II 30, , , Marie & Bill Ashby Endowed Presidential Scholarship in Engineering 30, , , Dr. Bobbie Morrow Dietrich Scholarship in Communication 28, , Stella Mullins Endowed Presidential Scholarship in Social Work 152, , , , Cecil Harrison Hale Endowed Scholarship 19, , , Bill Patman Endowed Scholarship 27, , Mark & Pamela Callahan Endowed Pres Scholarship in Actuarial Studies 54, , , Dr. J. Parker Lamb Endowed Presidential Fellowship in Mechanical Eng 162, , , Leslie Blanton Plan II Study Abroad Endowment 54, , , H. L. Brown, Jr. Endowed Pres Fellowship in Petro & Geosystems Eng 62, , , Phi Gamma Delta Endowed Scholarship 35, , , Ron & Linda Bowen Endowed Presidential Scholarship in Engineering 33, , , , Brittany Brown Scholarship in Music 25, , , David & Kim Kennedy Endowed Pres Shcolarship in Petr & Geosystems En 67, , , , Lennart & Daniel Korpa Memorial End Pres Schol in Music Education 53, , , Robert C. Maley Scholarship 106, , , Dr. Brooks Fowler Endowed Graduate Fellowship 98, , , , William Muehlberger Graduate Fellowship in Structural Geology/Tectonics 265, , , , Bernice H. Burum Graduate Fellowship 69, , , Weaver Endowed Scholarship in Accounting 50, , , , , Jennifer Tune Jorns Endowed Scholarship in Art 26, , , Keith Charles Endowed Scholarship in Theatre and Dance 27, , James & Shannon Haddaway Endowed Presidential Scholarship in Liberal 100, , , Amy & Clement Marcus Family Endowed Scholarship in Business 87, , , , Manuel Luna Garay Endowed Scholarship 36, , , , Justin R. and Gloria H. Driscoll Endowed Pres. Scholarship in Mech.Engine 41, , , , Courtney and Doug Swanson Endowed Scholarship In Business 25, , Vada A. and Walter V. Boyle Graduate Fellowship in Petroleum Geology 146, , , , , Charles & Karen Matthews, Jr. 40 Acres Scholarship in Business 528, , , Michael Alan Henney Endowed Memorial Scholarship in Engineering 32, , , Richard Cabballero Undergraduate Scholarship in Business 35, , , , , Jonilu Swearingen Nubel Endowed Scholarship 152, , , Marian and James Wysong Scholarship in Business 124, , , , Nuenschwander Endowed Presidential Scholarship in Business 142, , , Mary Elizabeth Sherrill Endowed Presidential Scholarhsip in Organ 101, , , Ethel Gene Kahmer Endowed Scholarship 29, , , (621.11) , Janet Riha Neissa adn Jimmy Neiss a Endowed Scholarship in Business 407, , , Ruth Ellen adn J.L. Riha Endowed Memorial Scholarship in Business 101, , , Gerald & ellen Harden Endowed Scholarship and Fellowship Program 509, , ,875.94
144 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Hettie Nel Endowed Scholarship in Piano 24, Charles M. Nettles Endowed Presidential Scholarship 48, Texas Assoc of County Engineers & Road Administrators Scholarship 25, Business Honors Program 40 Acres Scholarship in Business 230, Eugene A. Malish Endowed Presidential Scholarship 50, Monsignor Fred Bomar Endowment 40, David Deutch Endowed Presidential Scholarship 40, , Leslie & Jack Bergeron Endowed Presidential Scholarship 57, , T. Keller Towns Endowed Scholarship in Mechanical Engineering 49, T. Keller Towns Endowed Presidential Scholarship in Mechanical Engineeri 49, Goldman Sachs/Ted Wang Scholar Fund 203, James C. & Aubra Tabor Shaw Memorial Fund 84, Ward Creative Communications, Inc. Scholarship 24, Goodman Schnitzer Scholarship in Business 100, Jenny & Thomas Hoang Endowed Scholarship 23, Kevin Underhill Memorial Endowed Presidential Scholarship 250, Shaffer Graduate Fellowship in Law Librarianship & Legal Information Stud 50, Wayne Edwards Sr. & Wayne Edwards Jr. Memorial Scholarship 24, Robert Junge Friends of Alec Endowed Scholarship in Chemical Engineerin 19, , Jerry Clay Endowed Presidential Scholarship in Petroleum Engineering 26, , Cristina & Blake Sellers Endowed MBA Scholarship 203, , Carolina Alcocer Endowment for Scholarship and Creativity in the Arts 29, , Russell Lee Endowed Scholarship in Photography 90, , Rob Jones Scholarship in Business 99, Good Neighbor Pharmacy Endowment 24, Stephen & Jane Dabney Scholarship in Business 63, Nisankarao Rao Endowed Scholarship in Chemical Engineering 15, , Donna Burkett, John Rogers, Jeanette Burkett, & Marjorie Joseph Scholars 9, , Houston Texas Exes Chapter 40 Acres Scholarship in Business 528, Todd Dunn Family Scholarship in Business 24, Stuart W. Stedman 40 Acres Scholarhip for Plan II 474, Mary & Piero Puccini Endowed Scholarship 26, , Michael Thomas Endowed Fellowship 48, Lee & Lelia Beckelman Endowed Presidential Scholarship in Business 48, The Honorable John Wildenthal Endowed Presidential Scholarship 47, Archie C. Roberts Family Endowed Scholarship 30, , Jess Palmer Randall Endowed Scholarship in Engineering 48, Julie & Brook Syers Endowed Scholarship 44, , Frederic & Estelle Morse Endowed Scholarship 115, , James Elkins Ill Endowed Presidential Fellowship in Finance 589, , Hamptom Family Friends of Alec Endowed Scholarship in Petroleum Eng in 24, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ' , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~ 20, , Vl ,
145 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 ~ w (J) Net Position Gift Additions to September 1, 2012 Endowments Dr. Michael J. Acuna Endowed Scholarship 27, Burke & Elizabeth Baker Memorial Scholarship 16, , Deans Scholars Endowment 31, , Robert Edsel Endowed Scholarship in Art History 9, , Lois Sager Foxhall Endowed Presidential Scholarship in Journalism 47, Elizabeth & John Massey Forty Acres Scholarship in Business 522, James Mirabal, P.E. Endowed Schoalrship in Civil, Arch & Env Engineering 23, Schwab Building Company Friends of Alec Endowed Scholarship in Engine 9, Pinar Oya Yilmaz & Zeynep Atalay Undergrad Scholarship in the Geoscienc 21, , Goldman Sachs Scholars Bill & Kelly Montgomery Scholarship Fund 247, Alfredo Garcia, Jr. Endowed Presidential Scholarship in Pharmacy 34, , R. Gordon & Louise Appleman Graduate Fellowship 47, Myra Atwell McDaniel Endowed Scholarship in Business 98, Thomas Gilligan Endowed Scholarship in Business 98, El Paso Scholars Endowed Scholarship 26, Larry Jones Deloitte Foundation endowed Memorial Fellowship in Accounti 391, Stephen Hubbard Hudson Endowed Scholarship in Engineering 26, , Jordan Family Foundation Endowed Scholarship 26, Eli a & Susana King Excellence Endowment 9, , Mary Kathleen Christenberry Pratt Scholarship in Business 4, , Jack & Maxine Zarrow Endowed Graduate Fellowship in Engineering 193, , Susie & John Adams Forty Acres Scholarship in Business 522, Cardinal Health Scholarship in Pharmacy 48, James Stephens Memorial Scholarship Fund 81, , Charles Simmons Endowed Presidential Fellowship in Engineering 188, Virginia Webb Payne endowed Scholarship in Art 24, Robert M. "Jack" Howe Friend of Alec Endowed Scholarship in Engineering 39, , Mr. & Mrs. Cheng-Fong Maa Endowed Scholarship in Engineering 24, Hou-Li Scholarship in Natural Sciences 24, Gordon Griffin, Jr. Endowed Scholarship in Petroleum & Geosystems Eng in 24, Dominic & Patricia Sung Endowed Scholarship in Business 25, , Melissa Richards Smith Endowed Scholarship 5, Joy Chandler Endowed Scholarship in Organ 10, , Richard B. Dyke Endowed Presidential Scholarship in Communications 50, , John & Wendy Jennings endowed Presidential Scholarhsip 48, Dror Goldberg Scholarship in Business 5, , Laura Hampton Rogers Endowed Presidential Scholarship 97, J. Jeff Weidner Endowed Scholarship in Chemical Engineering 6, , Paige Hazeltine Weidner Endowed Scholarship in Kinesiology 10, , Goldman Sachs Gives/Paul Aaron Endowed Presidential Schol in Business 224, Ya-Long Pai Memorial Undergraduate Scholarhsip in Business 100, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) , , , , , , , , , , , , , , , , , , , Net Other Additions/ Deductions , , , Net Position August31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,535.87
146 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Tim, Nancy & Kristen Carter Family Endowed Scholarship in Business 10, , Bob Rowling Scholarship in Business 99, Afren Management Endowed Graduate Fellowship in Engineering 494, , Carrin Foreman Patman Plan II Scholarship 376, Bill Patman ROTC Scholarship 132, Wilburn Bohne Friends of Alec Scholarship in Engineering 568, Sirgo Family Endowed Scholarship in Mechanical Engineering 18, , Frederick Martin Scholarship 27, Larry & Sarah West Presidential Scholarship 12, , Bonnie & Elton Lacey Endowed Scholarship 6, , Caroline Kinnear Endowed MBA Scholarship 105, , Mona & Paul Knopp Scholarship in Accounting 12, , John & Katherine Ehrle Endowed Scholarship 15, , Fran & Tom Callahan Scholarship in Business 15, , Aim Foundation Forty Acres Scholarship in Business 1,020, Colonel Archer M. Baird Scholarship in Plan II 12, , Blair Scott, Jr. Endowed Pres Scholarship in Petroleum & Geosystems Engi 76, , Anne & Biren Smith Endowed Presidential Scholarship in Business 101, , Eugenia & Richard Renaudin Scholarship in Business 5, Reid Kirchem Scholarship in History 27, Marsha Malish Jones Endowed Presidential Scholarship 51, Dr. Timothy W. Ruefli Scholarship in I ROM 57, Texas Amateur Astronomers' Scholarship 9, , The N.S. & Dorothy Marrow Scholarship Fund 477, Jeffrey Mikeska Endowed Presidential Scholarship in Aerospace Engineerin 16, Margery Engel & Robert Loeb Graduate Fellowship in Social Work 26, , Jerry Blaylock, RN, EDD, FAAN Endowed Scholarship in Nursing 24, Christy & David Dauphin Graduate Fellowship in Nursing 9, , Jewel Hagan Endowed Scholarship in Nursing 5, Tu-Ting & Rachel Tsan Endowed Scholarship in Social Work 22, , Graham F. Carey Scholarship in Computational Science 15, , Larry Parks Endowed Scholarship in the McCombs School of Business 5, , Paul Olefsky Cello Scholarship 10, , Fred & Frances Oliver Endowed Scholarship 61, , Maurice Florance Energy & Earth Resources Scholars Fund 299, Coats Scholarship 24, , Grace Hanson Endowed Presidential Scholarship 99, Snohetta Endowed Scholarship in Architecture 24, Thomas & Shari Fish Endowed Scholarship in Real Estate 5, , Richard Schmidt Scholarship in Business 99, , Johnson-Bates Respect and Inclusion Endowed Presidential Scholarship 37, , Net Increase Investment (Decrease) In Fair Income (Realized Net Other Investment Value of Gains and AddiUons/ Net Position Income Investments Losses) Deductions August31, , , , , , , , , ?8 136, , , , , , , , , , , , , ,056, , , , , (9,705.49) 105, , , , , , , , , , , (41.40) , , , , , , , , , , , , , , , , , , , , , , ~ w 1, ,
147 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, "' 00 Net Position Gift Additions to September 1, 2012 Endowments Elizabeth Yant MPA Scholarship in Business 40, , Engler Family Graduate Fellowship in English 15, , A vital Stolar Endowed Scholarship in Theatre 5, , Heather Dealy Memorial Scholarship 15, , Susan Neff Endowed Presidential Scholarship for Education 9, Richard "Cactus" Pryor Scholarship 24, Chevron Engineering Alumni Endowed Scholarship 28, , Damon & Amy Davis Endowed Presidential Scholarship in Civil Eng 35, , Friends of Cello Scholarship 267, , Aaron & Amy David Endowed Schol in Petroleum and Geosystems Eng 12, Larry Lake Endowed Presidential Scholarship in Petroleum & Geostystems 51, , McPeake-Schuler Family Endowed Presidential Scholarship 51, Neil & Amy Leibman Endowed Presidential Scholarship 20, Denson Endowed Scholarship for First-Generation Students 52, , Pricewaterhousecoopers/Lauren Huddleston Memorial Endowed Scholarshi 71, , Cindy & Mike Zeglin Endowed Graduate Fellowship in Chemical Engineerin 20, , Nicolas & Maria Weber Electrical Power Endowed Scholarship in Elect Engi 10, , Ruth Rubio & L.V. Sclerandi, Jr. Endowment 5, , Robert Graham Endowed Presidential Scholarship in Business 259, Eric & Shanna Bass Endowed Presidential Scholarship in Business 256, Herb Miller Endowed Presidential Scholarship 25, , Lester & Linda Allison McCombs Presidential Scholarship 51, , Moreland Family Endowed Presidential Scholarship in Business 255, Ala ina Hanson Endowed Presidential Scholarship 10, , Joyce & Claude Cooke Endowed Scholarship for UTeach 25, , Emba Legacy Scholarshp Fund 43, , Connie McMillan Endowed Scholarship in Theatre Studies 5, , Cory & Priscilla Redding Family Scholarship 102, , Kimberly & Glen Wind Endowed Presidential Scholarship Fund 20, , Dorothy & Rudy Martinez Family Scholarship 10, , RJ De Ayala & JP Doyle Endowed Scholarship 6, , David & Sandra Dotter Friends of Alec Endowed Scholarship in Eng 22, , Christopher & Christine Manning Endowed Scholarship for Business 10, Siawe Endowed Scholarship 35, , Dr. Bennie Walker Endowment 1,228, Griffin Family Endowed Scholarship in Engineering 5, , Elizabeth Norwood Graduate Fellowship in Nursing 51, Blocker-Cramer Endowed Scholarship Fund 351, Jerry & Martha Hawkins Endowed Scholarship in Engineering 13, T.J. & Yeh-Min Maa Friends of Alec Endowed Scholarship in Chemical Engi 5, , Phillips 66 Endowed Scholarship in Business 45, Net Increase Investment (Decrease) in Fair Income (Realized Investment Value of Gains and Income Investments Losses) 1, , , , , , , , , (291.08) , , , , , , , , Net Other Additions/ Deductions 10, , , , , Net Position August 31, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,271 ' , , , , , ,106.09
148 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments George & Pamela Ackert Endowed Dean's Scholarship in Business 25, Christopher Cornett Scholarship for Excellence in Busines 35, , Myra & Dennis Dria Endowed Scholarship 7, , Jarnes & Merle Fair Endowed Graduate Fellowship in Chemical Engineerin 51, , Frank Family Foundation's Leonard Eichner Endowed Presidential Scholars 10, , Ada & Paul Kinscherff Endowed Scholarship 20, , W.K. Milner, Jr. Endowed Scholarship in Music 30, Carl & Tamara Tricoli Endowed Fellowship 20, , James Dunnam & Hugh Brady Scholarship in Liberal Arts 5, , Kurt Schwing Fellowship 25, , St. David's Foundation Bilingual Social Work Scholars Endowment 2,000, Mabel Wandell Endowed Scholarship Fund 14, Yvette Atkinson Memorial Scholarship in Architecture 20, , John & Judye Hartman Endowed Scholarship 5, , Ray & Denise Nixon Endowed Dean's Scholarship in Business 125, Seilheimer Endowment 64, Alfred & Jewel Rowe Scholarship in Plan II and Engineering 50, McPeake-Shuler Family Endowed Presidential Scholarship in Engineering 2 50, Jacobe Family Endowed Dean's Scholarship in Business 50, Courtney & Cindy Brien Endowed Presidential Fellowship 20, Carver-Whitbread Endowed Scholarship in English 25, George Forgie Endowed Scholarship in History 25, Trimble Prize for Excellence in Writing 2, David Nilsson Scholarship for University of Texas Libraries Student Worker 25, Rachel & Tu-Ting Tsan Endowed Scholarship in Education 18, Kleiderer Family Scholarship in Business Beth & Jim Barnum Endowed Scholarship in Petroleum & Geosystems Engi 25, Hy & Amy Hetherington Endowed Presidential Scholarship 10, Drs. Miles & Audra Day Scholarship 5, Rocky & Violet Han Scholarship 4, Robert Dewar Endowed Scholarship 1, Aaron & Bethany Gibson Scholarship 5, Sharon Justice Leadership Scholarship Endowment 51, Nicholas Graham Bayley Endowed Scholarship 3, Martin Dynasty Trust Endowed Dean's Scholarship in Business 50, Olin Cable, Jr. Endowed Presidential Scholarship in Accounting & Finance 50, Steve Barton Endowed Presidential Scholarhsip in Musical Theatre Elizabeth & Gantt Walton Endowed Scholarship 25, Mark Clernent Endowed Presidential Scholarship 50, Lorrie & Ken Deangelis Endowed Presidential Scholarship in Business 50, Patty & James Huffines Endowed Presidential Scholarhip in Business 100, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , , , (8.02) 69, , , , , , , , , ' , ,070, , , , , , , (113.35) 65, , , , ' , (22.31) , , , , , , , (17.26) 9, , , , , , , , , , (27.94) 28, , , , (48.53) (14.29) 1, , , , , ' , (27.78) 50, , (231.78) (64.40) , (28.02) (421.50) 50, ~ (27.78) 49, w (55.55) 99, co
149 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013.j>. 0 Net Position Gift Additions to September 1, 2012 Endowments Ray & Denise Nixon Endowed Presidential Scholarship in Business 100, Roger & Helen Krone Family Endowed Scholarship 5, Chris & Sterling Abbott Endowed Scholarship 8, Lowell Lebermann, Jr. Scholarship Fund 25, Betty & James Key Endowed Scholarship 25, Kenneth Minix Endowed Scholarship Fund 885, Wayne & Glenda Dayton Endowed Presidential Fellowship 40, The Sharplin Family Endowed Dean's Scholarship in Business 125, Jim & Barbara Miller Endowed Scholarship in Chemical Engineering 25, Charles & Diana Stevens Endowed Scholarship in Engineering 30, Martin Dies, Jr. Liberal Arts Honors Study Abroad Scholarship 250, The Honorable Marth Wong, Ed.D. Scholarship in Asian-American Studies 12, Marion Buescher Memorial Scholarship Marc & Jan Myers Endowed Dean's Scholarship in Business 25, Mize Family Endowed Dean's Scholarship in Business 62, The Nicholls Family Friends of Alec Endowed Scholarship in Chern Enginee 15, Neal Rayburn Ellis Endowed Scholarship Oletta Jo Klein Scholarship Susie & John Adams Endowed Dean's Scholarship in Business Susie & John Adams Endowed Presidential Scholarship in Business Michael Glazer Endowed Dean's Scholarship in Business 25, Interstate Capital Corporation Endowed Scholarship 10, Jastro Presidential Scholarship 50, Donald & Joan McNamara Endowed Scholarship in Real Estate 10, Jeanne Amacker Endowed Scholarship in Education 18, McGlamery Graduate Fellowhship Ben Ramsey Endowed Scholarship Fund 2, Roger, Linda, Sarah, & Stephanie Camp Endowed Scholarship 10, Elizabeth & John Massey Endowed Presidential Scholarship 250, Chris & Mike Mizell Endowed Scholarship 5, Andrew Phong Vo Endowed Presidential Scholarhsip in Business Fund 62, Bettie & Greg Browning Endowed Scholarship in Mechanical Engineering 25, Tom & Fran Halbouty Endowed Graduate Fellowship in Petro and Geo Syst 10, Stephen & Nancy Thorington Endowed Presidential Scholarship in Busines 179, W. Dawson Sgterling Endowed Presidential Scholarship 16, Applied Political Strategies Endowment 50, Musselman Family Scholarship 5, John Mark Hughes Endowed Presidential Scholarship in Engineering 30, Cole Williams Adams Memorial Endowed Presidential Fellowship in Social Fred Gottesman Forty Acres Scholarship Billy Carr Distinguished Teaching Fellowship 50, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) (55.55) (3.52) (5.65) (229.84) (13.89) (492.06) (252.53) (69.44) (13.89) (286.86) (138.89) (6.65) (13.89) (13.89) (34.41) (382.52) (51.56) (13.89) (3.52) (69.15) (138.26) (13.89) (5.54) (27.78) (5.54) (147.64) (37.09) (52.48) (1,290.56) (3.52) (841.32) (229.84) (5.54) (603.61) (6,143.90) (132.79) (603.61) (60.36) (150.93) (1,207.22) (3,567.75) (1,248.90) Net Other Additions/ Deductions , , , , , , , , , , , , , Net Position August 31, , , , , , , , , , , , , , , , ,948;44 24, , , , , , , , , , , , , , , , , , , , , , , , ,203.89
150 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, Eleanor Moore Memorial Endowed Presidential Scholarship David Knaggs Endowed Scholarship Mike and Lisa O'Leary Endowed Scholarship Amy King Endowed Scholarship in Accounting Dr. McClure Scholarship in Management Information Systems Wombwell Family Endowed Scholarship in Law The Honorable Hilmar Moore Endowed Scholarship J. David Gavenda Scholarship in Plan II Elizabeth Garcia Endowed Presidential Scholarship Shirley Bird Perry Leadership Award Christopher Anspach Friends of Alec Endowed Scholarship in Engineering E. Everett Deschner Endowed Scholarhip Timmins Endowed Graduate Fellowship in Chemical Engineering Hartmann Endowed Undergraduate Scholarship in Engineering Victor Piana Endowed Scholarship in Chemical Engineering X24 Exchange Lonestar Chapter Endowed Scholarship in Engineering Dr. Francis Bostick, Jr. Endowed Scholarship in Electrical Engineering Carlos and Clara Quintanilla Scholarship L. Joe & Heather Boyer Family Endowed Scholarship in Architectural Eng in Sun and Yim Yip Endowed Presidential Scholarship in Mechanical Engineer Hickman and Reynolds Team Spirit Fellowship Cristi & Kevin Ryan Endowed Scholarship in Accounting Carol & John Schweitzer Endowed Presidential Scholarship in Business Sheral Trousdale Skinner Endowed Graduate Fellowship in Social Work James Whittenburg Walker Memorial Endowed Scholarship Tim and Janice Go Endowed Scholarship in Chemical Engineering Anne Hart Rea and Jay Rea Endowed Scholarship in Athletics Dr. James Lee Martin Memorial Scholarship in Petroleum Geology Jack Hicks Endowed Scholarship in Fine Arts Chet Flippo Journalism Scholarship Spirit of Midland Endowed Presidential Scholarship in Business Sue and Frank McBee Fellowship in Historic Preservation Dede and Joe Bill Watkins Endowed Scholarship The Mitchell Family Endowed Scholarhip in Chemical Engineering Algarotti-Pfaffenberger Endowed Scholarship in Business Nelson Turner Allison Endowed Scholarship Bauer Family Endowed Scholarship in Business Matt Casey Memorial Scholarship in Architecture Martha Gooding Endowed Presidential Scholarship in Nursing Gruber Family Endowed Scholarship LBJ Class of 1982 Fellowship Endowment Net Position September 1, 2012 Gift Additions to Endowments 100, , , , , ,000, , , , , , , , , , , , , , , , , , , , , , , Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August31, 2013 (1,207.22) 98, (383.11) 31, , (60.36) , (60.36) , (60.36) , (60.36) 5, , ,000, , , , , , , , , (80.71) 6, , , , (603.61) , (482.89) 39, , , , , , , , , (9.43) 4, , , , , , , , , , , , , , , , , , , , , , , ~ 10, , ~ 61, , """
151 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, > N Net Position September 1, 2012 Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) Net Other Additions/ Deductions Net Position August31,2013 TOTAL SCHOLARSHIPS AND FELLOWSHIPS 581,248, ,765, ,879, (6,424.64) 3,820, ,707, AUXILIARY ENTERPRISES Betty Alexander Endowed Scholarship Albert A. Bennett Mathematics Prizes Grosvenor-Mckenna Endowment Fund For The Promotion Of Corrie Herring Hooks Publications Endowment Fund The Longhorn Associates Academic Achievement Betty A. Thompson Endowment For Recreational Sports The University Of Texas Press Endowment The Mrs. James R. Louise Moffett Basketball Endowment Defensive Football Coordinator Endowment Head Baseball Coach Endowment Head Football Coach Endowment Offensive Football Coordinator Endowment Head Swim Coach Endowment Head Golf Coach Endowment Patricia Ruth Cole Endowment For Excellence In Jack And Doris Smothers Series In Texas History, University Of Texas Press Neh Classics And The University Of Texas Press Neh Environmental Studies Clifton And Shirley Caldwell Texas Heritage Series Walter LAnd Sandra New Baseball Endowment Bill And Alice Wright Photography Series Roger Fullington Series In Architecture Charlene And Red Mccombs Endowed Excellence Fund For Joe R. And Teresa Lozano Long Series In Latin M. Georgia Hegarty Dunkerley Contemporary Texas Art Christine M. Bonci Sports Medicine Support Endowment Brad And Michele Moore Roots Music Series Texas Union-University Co-Operative Society Charles A. And Diane C. Baker Family Endowed Ash ely & Peter Larkin Classics Endowment 25, , , , , , , ,356, , ,095, ,427, , , , , , , , , , , , '156, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ' , ,404, , '133, ,512, , , , , , , , , , , , '197, , , , , , , , TOTAL AUXILIARY ENTERPRISES 10,438, , ,896, TOTAL TRUE ENDOWMENT FUNDS 2,649,094, ,538, ,577, (25,001.84) 12,823, ,786,008,532.71
152 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 Net Position September 1, 2012 Gift Additions to Endowments Investment Income Net Increase (Decrease) in Fair Value of Investments Investment Income (Realized Gains and Losses) Net Other Additions/ Deductions Net Position August 31,2013 TERM ENDOWMENT FUNDS INSTRUCTION Center For Arabic Study Abroad Endowment 696, , , TOTAL INSTRUCTION 696, , , RESEARCH Hubert Collins Endowment For The Bureau Of Economic 4,139, , , ,569, TOTAL RESEARCH 4,139, , , ,569, ACADEMIC SUPPORT Gottesman Family Endowment Fund _ Victor Ramon Divila Sr. Chair in International Trade Policy Osher Lifelong Learning Institute Endowment Elizabeth Gleeson Excellence Endowment in Plan II Physics Cain Foundation Endowment for Gaming Design Hicks Endowed Excellence Fund for the Center for Students in Recovery 659, , ,168, , , , , , , (669,294.24) 33, , ,245, , , , ,211, (27.78) 74, (6,035.98) 493,964,02 (301.81) 25, , TOTAL ACADEMIC SUPPORT 2,785, , , , (588,928.73) 3, 150, INSTITUTIONAL SUPPORT Sanford And Lisa Gottesman Endowment Fund 1,181, , (51,126.98) (1,229,368.81) TOTAL INSTITUTIONAL SUPPORT 1,181, , (51,126.98) (1,229,368.81) SCHOLARSHIPS AND FELLOWSHIPS Garnet G. Starkey And Clyde E. Starkey Scholarship Nicholas J. Ferrara Memorial Scholarship 85, , , , , (977.06) (74,689.91) 530, TOTAL SCHOLARSHIPS AND FELLOWSHIPS 669, , (977.06) (74,688.43) 618, TOTAL TERM ENDOWMENT FUNDS 9,472, , , (33,911.18) (1,607,031.19) 9,060, ~... w
153 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, 2013 ~ t Net Position September 1, 2012 Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31,2013 FUNDS FUNCTIONING AS ENDOWMENTS INSTRUCTION RESTRICTED _ Edwin Allday Lectureship In Geological Sciences 459, _ Ralph E. Alston Centennial Lectureship 144, _ E. C. H. Bantel Professorship For Professional 362, _ Leland Barclay Fellowship In Engineering 139, _ James E. Bauerle Centennial Professorship In Drug 1,049, K. Bouwsma and Douglas N. Morgan Undergraduate 39, Geology Foundation- L. W. Callender Memorial Fund 197, _Center For The Study Of American Architecture 87, _ Centennial Visiting Lectureship In Chemistry 270, _ Department Of Chemistry Excellence Endowment 344, _ Billy Bob Draeger Friend Of Alec Research Fund 37, _ Engineering Foundation Professorship 386, Friend Of Alec Excellence Fund Quasi 2,477, , College Of Business Administration Foundation-Richard Gonzalez Lectur 119, _ Mike Hogg Professorship In Community And Regional 669, _Mike Hogg Professorship of Local Government 986, _ Mike Hogg Professorship Of Urban Management 963, _ Paul Hollingsworth Lectureship In Engineering 71, _ Mike Hogg Professorship Of Urban Policy 1,038, Archer M. Huntington Museum Fund 24,591, _ Wolf E. Jessen Endowment Fund 182, _ William E. Lake, Jr. Excellence Fund For Architecture 343, _ Banks Mclaurin Fellowship In Engineering 130, _ Music Education Endowment Fund 175, _ Elspeth Rostow Excellence Fund 96, Sheffield Faculty Excellence Fund 474, _ Bettie Margaret Srnith Chair In Environmental Health 1,248, _Bettie Margaret Srnith Lectureship In Water Resources 88, _ Bettie Margaret Smith Professorship In Engineering 346, _Jewel McAlister Smith Professorship In Engineering 349, _ Lowber Snow A.S.C.E. Development Fund 36, _ Louis T. Yule Fellowship In Engineering 118, E. W. And Helen Franke Engineering Foundation Endowed 672, , ' , , , , , , , , ,086, , , , , , , , , , , , , , , , (5.49) ,571, , , , , , (73,815.30) 944, , , , , , ,074, , ,455, , , , , , , , , , , , , , , , ,313, , , , , , , , ,348,84 4, , , ,304.64
154 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Mike Hogg Professorship In Community Affairs 1,087, John And Elizabeth M. Teagle Scholarship In Petroleum 1,718, The Baker And Botts Professorship In Law Joseph C. Hutcheson Professorship In Law 44, Ben Gardner Sewell Professorship In Civil Trial 112, Robert F. Windfohr And Anne Burnett Windfohr 59, Joe A. Worsham Centennial Professorship In Law 190, George W. LoW1her Friend Of Alec Excellence Fund 21, E. J. Lund Marine Science Institute Support 434, Department Of Advertising Various Purposes 269, , Justin Wilson Memorial Forensics Endowment Fund 44, Joseph D. Jamail Excellence Fund 41, William H. Wade Endowed Professorship In Chemistry 373, Interior Design Endowed Excellence Fund 39, Bill Francis Chair'S Discretionary Fund, Department 115, Edwin W. And Alyce 0. Carroll Collection 17, Mary Lu Joynes Endowment 1,750, Max L. Williams Endowed Graduate Fund In Mechanics Of 135, Plan Ji Excellence Endowment 95, John A. And Katherine G. Jackson Chair In Geosystems 885, John A. And Katherine G. Jackson Chair In Applied 891, School Of Human Ecology Excellence Endowment 61, , Hugh Gragg Educational Endowment 52, The Hugh Gragg Undergraduate Research Travel Award In 17, Larry R. Faulkner Endowment For Excellence In 491, Ices Excellence Fund 9,264, Margaret Mayer Ward Endowment For Excellence In Journalism 53, College of Natural Sciences Excellence Endowment 3,081, Harry Ransom Centennial Fund for Curatorial Excellence 150, Ellen Clayton Garwood Centennial Professorship in Creative Writing #2 ( 77, Mossiker Chair in the Humanities #1 241, W.A. "Tex" Moncrief Jr Chair in Computational Engineering and Sciences 1 '157, Norman Hackerman Chair in Chemistry 102, TOTAL RESTRICTED 61,884, , UNRESTRICTED Roswell S. Nothwang Bequest 57, Professional Development Endowment In Mathematics 21, Julian C. Barton Professorship In Nutrition 241, Lee And Joseph D. Jamail Endowed Professorship In 137, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August31, , (520,943.44) 586, , , ,783, , , , , , , , , , , , , , , (309.16) 7, , , , , , , , , , , , , , ,811, , , , , , , , , , , , , , , , , , , , , ,693, , , , , 189, , , , , , , , '198, , , ,162, (314.65) (414,421.04) 63,794, , , , , , ~ 4, , >- 01
155 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, j>. 0> Scaljon Family Excellence Endowment William H. Wade Administrative Endowment In Chemistry C. T. Wells Professorship In Project Management Quasi Henry M. Rockwell Chair In Architecture Henry M. Rockwell Endowed Excellence Fund TOTAL UNRESTRICTED Net Position September 1, , , , ,137, , ,567, Gift Additions to Endowments Investment Income Net Increase (Decrease) in Fair Value of Investments 4, , , , , Investment Income (Realized Gains and Losses) Net Other Additions/ Deductions Net Position August 31, , , , ,177, , , ,657, TOTAL INSTRUCTION 64,452, , ,252, (314.65) (414,376.66) 66,452, RESEARCH RESTRICTED Alma!dell Carlson Fund W. J. Mcdonald Observatory Fund VanderPoel Fund For Research And Publication Exhibitions And Conferences Endowment Will C. Hogg Memorial Fund Quasi Bureau Of Economic Geology Beg Research Endowment D. J. And Jane Sibley, Jr. Plant Biology Graduate John & Katherine Jackson Chair in Earth System Sciences 251, , , , ,692, ,883, , , , , , , , , , , , , ,786, , , ,751, , , , , TOTAL RESTRICTED 15,208, , , , ,268, UNRESTRICTED William Shive Biochemical Research Endowment 269, , TOTAL UNRESTRICTED 269, , , TOTAL RESEARCH 15,477, , , , ,547, ACADEMIC SUPPORT RESTRICTED _ Humanities Support Fund The Rudolph Kleberg Law Library Fund Sharp Pioneer Oil Project Endowment _ Bettie Margaret Smith Endowment For Professional Development _ Bettie Margaret Smith Centennial Room _ Bettie Margaret Smith Centennial Room _ Lowber Snow Faculty Development Fund _ Lowber Snow Professional Development Fund Garwood-Clayton Fund Raybourne Thompson Centennial Professorship In Law 413, , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,887.74
156 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds - Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Germanic Languages Endowed Graduate Student 21, Minnie Lee Barrett Shepard Endowment 62, , Beryle Evelyn Burdyn Excellence Fund In Chemical 64, Gift Publications Endowment 602, The Harold W. Billings Staff Honors Endowment 28, Emily Knauss Library Endowment For The Liberal Arts 1,002, Marine Science Institute Advisory Council Library 77, Center For American Architecture And Design Endowed 40, Mccombs Business School Endowed Excellence Fund 6,854, Mac Tichenor Endowed Excellence Fund 136, Ransom Center Endowment For Education And Public 63, Warren J. And Viola Mae Raymer Excellence Fund 382, John A. And Katherine G. Jackson Chair In Energy And 1 '104, The Charles A. Dana Center Excellence Fund 467, John A. And Katherine G. Jackson Decanal Chair In The 1,511, The Paul T. Seashore Acquisition Fund 969, Friends Of Alec Equal Opportunity In Engineering 122, Eric J. Hultberg Student Professional Development 11, Paul G. And Martha L. Jeffries Endowed Excellence 34, Real Estate Finance And Investment Center Endowment 1,592, Eyes of Texas Student Government Academic Endeavor Fund 58, Robert Gerdes Music Program Endowment 266, Jean Andrews End for Preservation and Study of Historical Textiles and A 121, Leopold Tedesco Educational Endowment 204, Institute for Geophysics Excellence 762, Thomas F. Staley Endowment for Excellence in the Humanities 410, Recreational Sports Divisional Endowment 163, , Texas Program in Sport and Media Endowment 282, Annette Strauss Institute Civic Education Fund 242, John McKetta Maintenance Fund 188, School of Social Work Anniversary Excellence Fund 25, Writer-in-Residence Endowment 432, , Amy Jo Long Endowment for Excellence in Journalism 105, Thomas G. Smith Endowed Fund 29, Frances Leathers Holsey Library Excellence Fund 358, Kent Butler Memorial Excellence Fund in Community & Regional Planning 14, J.H. Robinson Charitable Trust Endowment in Human Ecology 162, Endowed Curatorship of European Art 9, _ IEEE UT Austin Student Branch Endowed Excellence Fund 10, , Mike Hogg Professorship in Liberal Arts # Oscar Brockett Center Excellence Fund 12, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, , , , , , , , , , , ,037, , , , , , ( 1,918, ) 5,174, , , , , , , , , '148, , , , , , ,572, , ,003, , , , , , , , ,438, , , , , , , , , , , , , , , , , , , (3, ) (74,995.81) 174, , , , , , , , , , , , , , , , , , , ~ 20, , , , , ,
157 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, 2013 ""' "' Net Position Gift Additions to September 1, 2012 Endowments CAM Chair in Visualization Salam Fayyad Excellence Fund for Economics Fennessey Ranch Conservation Endowment 300, Andrea Ogilvie Honorary End Excellence Fund for Equal Opportunity in E Department of Computer Science Excellence Fund 228, Mary Boyvey Endowed Presidential Scholarship in Youth and Information 1 '169, Rom Rhome International Professional Development Fund M. J. Thompson Regents Professorship in Aerospace Engineering Lois Trice Endowed Scholarship in Plan Robert Witt Fraculty Excellence Fund Michael Wiley Hydrogeology Library Fund Student Organization Development Fund W. A. "Tex" Moncrief, Jr. Chair in Computational Engineering and Science Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) (1,810.84) (3,621.60) (14.25) (56.54) (649.84) (40.99) (128.56) (14.44) (92.03) (3,768.04) (1,388.31) Net Other Additions/ Deductions 150, , , , , , , , , ,000, ,953, Net Position August 31, , , , , , '168, , , , , , , ,000, ,765, TOTAL RESTRICTED 20,150, ,951, , (3,038.12) UNRESTRICTED Communication Foundation-Office Of The Dean-School Of 160, Hilda Barnard Undergraduate Library Collection And 25, John W. Cox Endowment For The Advanced Studies In 4,064, Joanne Sharp Crosby Theatre Outreach Endowment 124, Music Leadership Program Endowment 49, Jack S. Blanton Museum Of Art Operating Endowment 552, Marye Anne Fox Endowed Presidential 125, Lissner Endowment In Public Relations 66, The Charles A. Dana Center Excellence In Education 911, _ Goldye Levi Endowment Chair in Physics 1,021, Chair in Mathematics 1,021, Chair in Philisophy 1,021, Chair in African and African Diaspora Studies 1,021, Estate of Dr. Allen Cobble Ray Endowment 579, Alton Diserens fund for the Center for Art of Africa and its Diasporas 300, Richard Johnson-Welch Regents Chair in Chemistry Welch Regents Chair in Chemistry Paul Woodruff Endowment for Excellence in Undergraduate Studies Chair in Mexican American Studies 5, , , , , , , , , , , , , , , , , (12,072.03) 406, ,118, (3,038.03) , , (0.09) 45, , , , ,000, ,532, ,485, , , ,207, , , , , , ,299, '1 02, ,057, ,057, ,057, , , , , , , ,984, ,749, TOTAL UNRESTRICTED 11,045, TOTAL ACADEMIC SUPPORT 31,195, ,951,932.19
158 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August31, 2013 Net Position September 1, 2012 Gift Additions to Endowments Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31, 2013 STUDENT SERVICES RESTRICTED L. L. And Ethel E. Dean Honors Program Endowment 2,639, Texas Union Student Programs Endowment 156, Orientation Leadership Fund TOTAL RESTRICTED 2,881 ' UNRESTRICTED Alderson Endowed Lecture Series 30, International Student Assistance Fund 50, TOTAL UNRESTRICTED 81, TOTAL STUDENT SERVICES 2,962, , , ,733, , , , , , , ,983, , , , , , , , , ,067, INSTITUTIONAL SUPPORT RESTRICTED _ Mike Hogg Fund 11,134, John A. And Katherine G. Jackson Fund For Energy And 1,004, Center For Students In Recovery Fund 28, Play Golf America University Endowment In Kinesiology And Health Educ 97, TOTAL RESTRICTED 12,264, UNRESTRICTED Brackenridge Tract Fund 596, Maud Mccain Harding Fund 15,455, _ Leona Lata Harris Endowment Fund 161, John Porter King, Jr., Fund 1,037, Grace M. Maverick Fund 2,617, Texas Archeological Research Laboratory Tarl 608, , Shirley Bird Perry Endowment Fund for University History 9, TOTAL UNRESTRICTED 20,487, , TOTAL INSTITUTIONAL SUPPORT 32,751, , , ,525, , , ,041 ' , , , , , , ,698, (33,916.00) 562, , , ,001, , , , ,073, , ,709, , , , , , , '165, ,052, , ,863, SCHOLARSHIPS AND FELLOWSHIPS RESTRICTED...>..j:>. <D
159 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 _.. ()"1 0 Net Position Gift Additions to September 1, 2012 Endowments Dallas Daily Times Herald Scholarship Fund 42, _ Dan Danciger Scholarship Fund In Hebrew Studies 93, _ Billy Bob Draeger Graduate Research Fellowship 32, _ Israel Dreeben Memorial Scholarship Fund 90, Phil M. Ferguson Endowed Presidential Graduate 111, John A. Focht Endowed Presidential Graduate 93, Mary E. Gearing Scholarship In Human Ecology 150, John W. Hargis Endowed Presidential Scholarship 64, _ Kenneth G. Howard Endowed Centennial Scholarship 35, _ The John Dorlin Howson And Emilie Wheelock Howson 49, Anna And Fannie Lucas Memorial Scholarship 23, _ James M. Jimmy Malone Endowed Scholarship 48, Alma Piner Scholarship In Architecture 41, _ Plan II Alumni Endowed Presidential Scholarship 75, Power, Pirson, Plummer Memorial Scholarship 23, _Willis Pratt Endowed Scholarship 37, Tim G. Rogers Endowed Scholarship 27, _ The Bettie Margaret Smith Fund 31, _ Lowber Snow Scholarship/Fellowship Fund 91, M. J. Thompson Endowed Presidential Graduate 102, James H. And Minnie L. Edmonds Scholarship 3,839, JudgeR. L. Batts Endowed Presidential Scholarship In 183, Harriet Fiquet Batts Scholarship Fund For Graduate 181, Allen L. Roberts Endowed Presidential Scholarship In 1,236, Vinson And Elkins Endowed Presidential Scholarship In 58, Vinson And Elkins Endowed Presidential Scholarship In 58, Vinson And Elkins Endowed Presidential Scholarship In 58, Vinson And Elkins Endowed Presidential Scholarship In 58, The Tom Jones And Harvey Schmidt Endowed Presidential 88, John Reese Rothgeb Scholarship In Theatre 38, , Ella Kate And Wallace Ralston Nursing Students 281, William C. Liedtke, Sr. Professorship In Law 44, Robert Noyce/Sematech Endowed Graduate Fellowship 425, Graduate School Of Business Scholarship Fund 1,040, George And Frieda So utter Scholarship Fund Endowment 155, A. D. Hutchison Student Endowment Fund 3,412, Pat Hingle Endowed Presidential Scholarship In 74, William H. Emis Iii Traveling Scholarship In 120, Jacqueline Eckert Timm Endowed Scholarship In 23, Parents' Association Endowed Scholarship 18, Ching Yew Endowed Design Scholarship 43, , Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , Net Other Additions! Deductions , Net Position August 31, , , , , , , , , , , , , , , , , , , , , ,974, , , ,280, , , , , , , ' , , ,076, , ,532, , , , , ,359.97
160 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, 2013 Net Position Gift Additions to September 1, 2012 Endowments Texas Offshore Industry Endowed Scholarship 19, Marion Burck Smith Junior Fellowship Fund 613, Departmental Visiting Committee General Endowed 19, Petroleum Industry Endowed Scholarship 87, Harry M. Reasoner Endowed Presidential Scholarship In 42; Alice Brooks McGuire Endowed Scholarship 17, , Kara Spears Hultgreen Endowed Undergraduate 17, C. Glenn Sparks Endowed Presidential Scholarship 47, Macey Hodges Reasoner Endowment 434, Jennifer Sue Sparrgrove Memorial Endowed Presidential 44, Fred Murphy Jones Endowed Graduate Fellowships In 1,952, Howard F. Rase Undergraduate Scholarship In Chemical 71, Ricky Williams Endowed Presidential Scholarship In 12, International Education Fee Scholarship Program 2,162, British Studies Endowment 553, Jim Koeller Endowed Presidential Scholarship In 46, Dorothy C. Luther Scholarship In Nursing 59, Richard E. Rolle Memorial Scholarship 31, Marlin D. And Helen Bownds Memorial Endowment In Plan 343, Walter E. Millett Endowed Undergraduate Scholarship 147, Endowed Graduate Fellowship In Nursing Systems 71, Paul N. Banks Excellence Endowment 33, Equal Opportunity In Engineering Program Endowed 77, Mack Brown Endowed Scholarship In Kinesiology I 48, Mack Brown Endowed Scholarship In Kinesiology li 48, George W. Beck Endowed Excellence Fund 65, Mcclenney Endowment For Community College Student 218, A mit Garg Graduate Fellowship In Computer Sciences 20, John S. Werth Memorial Excellence Fund 29, William D. Moore Endowed Friends Of Alec Scholarship 159, Cliff Gustafson Baseball Scholarship 21, James F. Parker Endowed Scholarship In English 169, James F. Parker Endowed Scholarship In Social Studies 169, Claude M. Pendley, Jr. Memorial Scholarship Fund For 44, Rose M. Morris Scholarship Endowment Quasi 285, Michael R. Voich Endowed Presidential Scholarship In Architectural Eng 46, Julia Emerson Fisher Walther Endowment 10,659, Rebecca Carreon Scholarship Fund 145, , James Means Scholarship Fund 30, Alison Davis-Blake Endowed Scholarship 12, Myrtle & George Isensee Scholarship Endowment 16, Net Increase Investment (Decrease) in Fair Income (Realized Net Other Investment Value of Gains and Additions/ Net Position Income Investments Losses) Deductions August 31, , , , , , , , , , , , , , , , , , ,021, , , , , , ,455, , , , , , , ' , , , , , , , , ' , , , , , , , , , , , , , , , , , , , , , , , , , ,643.72, , , ,033, , , , , , (l , ~
161 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31, ()1 N Net Position Gift Additions to September 1, 2012 Endowments J.M. Aand Vola Mae Odom Scholarship 84, , _ Jeffry Mikeska Endowed Scholarship in Engineering 37, Chemistry and Biochemistry Authors' Scholarship 14, Fred Bullard Graduate Fellowship in the School of Information 864, Fred Bullard Student Research Fund in the Jackson School 1,302, H.T. Manuel & H. Paul Kelley Graduate Fellowship 341, Howard A. Halff Endowed Graduate Fellowship In Chemical Engineering 454, Stephen F. & Fay Evans Martin Endowed Presidential Fellowship in Che 106, James Franklin Beran Endowment in Pharmacy 447, John Wheeler Graduate Fellowship in Physics 33, Graham F. Carey Scholarhsip in Computational Science 27, Nims Graduate Research Fellowship 102, Bertha & Edward Hegar Endowed Scholarship in Engineering 51, J.H. Robinson Endowed Scholarship 332, Engineers' Fund/Louis Wagner Endowed Scholarship in Engineering 307, The Betty Himmelblau Endowed Scholarship for Women's Athletics Katie Murray Endowed Presidential Scholarship Katie Murray Endowed Presidential Scholarship II Mary Boyvey Chair for Excellence 50, Bernard Rosenstein Scholarship in History 60, Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Value of Gains and Investments Losses) 3, , , , , , , , , , , , , , , (603.61) (603.61) (27.78) (724.33) 1,266, , Net Other Additions/ Deductions , (142,994.25) 51, , , Net Position August 31, , , , , ,351, , , , , , , , , , , , , , , , ,978, TOTAL RESTRICTED , , , UNRESTRICTED Chimes Scholarship Fund 18, Faculty Memorial Fund In Microbiology 28, _ Anna Elizabeth Simmons Fund 177, Republic Of Mexico Solidaridad Endowed Presidential 80, Julian C. Barton Regents Endowed Scholarship In 238, Louis And Mary Lou Williams Endowed Scholarship In 77, J. W. Red Mccullough, Jr. Endowed Presidential 47, Education Annual Fund Endowed Presidential 169, Glissa Endowed Scholarship 24, C. R. Smith Endowed Scholarship Fund 3,474, Carolyn L. And Gerhard J. Fonken Endowed Presidential 89, Wilhelmina And Exalton Delco Graduate Fellowship 44, Intercollegiate Athletics For Women Memorial 47, Kay And Abraham Charnes Endowed Presidential 48, Ex-Students' Association Texas Excellence Awards 634, Will K. Brown Endowed Scholarship In Civil 42, David Deming Endowed Scholarship In Studio Art 46, , , , , , , , , , , , , , , , , , , , , , , , , ,597, , , , , , , ,105.12
162 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds- Other Than State As of August 31, Plan li Anniversary Endowment Coach Cleburne Price, Jr. Memorial Track Scholarship S. Allison Starr Pendergras Memorial Endowed Martin Luther King, Jr. Endowed Presidential Presidential Citation Endowed Presidential Brandon Cole Pittman Endowed Scholarship Renee Wolfe Zelman Plan li Excellence Endowment llrey Althea Sparks Endowed Scholarship For Beverly Kearney Endowed Scholarship For Excellence Edward Triggs Endowed Scholarship In Design Quasi Net Position Gift Additions to September 1, 2012 Endowments 232, , , , , , , , , , , Investment Income Net Increase Investment (Decrease) in Fair Income (Realized Net Other Value of Gains and Additions/ Net Position Investments Losses) Deductions August 31,2013 8, , , , , , , , , , , , , , , , , TOTAL UNRESTRICTED 6,138, , , , ,358, TOTAL SCHOLARSHIPS AND FELLOWSHIPS 42,457, , ,478, , ,337, AUXILIARY ENTERPRISES RESTRICTED Longhorn Scholarship Fund Texas Union Building Fund J. Frank Dobie Publications Endowment Golf: For Business And Life Endowment Nelson Puett, Jr. Endowment For Recreational Sports 697, ,532, , , , , , , ,656, , , , , , , TOTAL RESTRICTED 4,634, , ,797, UNRESTRICTED Ut Press General Endowment 1,271 ' , , ,326, TOTAL UNRESTRICTED 1,271, , , ,326, TOTAL AUXILIARY ENTERPRISES 5,906, , , TOTAL FUNDS FUNCTIONING AS ENDOWMENTS- RESTRICTED 153,343, ,278, ,369, , ,289, ,286, TOTAL FUNDS FUNCTIONING AS ENDOWMENTS- UNRESTRICTED 41,860, , ,387, ,591, ,855, TOTAL FUNDS FUNCTIONING AS ENDOWMENTS 195,204, ,293, , 757, , ,881, ,141, TOTAL ENDOWMENT FUNDS 2,853,771, ,707, ,687, (54,031.07) 17,097, ,005,210, ~ 01 (..0
163 1544 THIS PAGE INTENTIONALLY LEFT BLANK
164 Schedule B-6a Schedule of Changes in Net Position Endowment and Similar Funds -Other Than State As of August 31,2013 Net Position September 1, 2012 Gift Additions to Endowments Investment Income Net Increase (Decrease) in Fair Value of Investments Investment Income (Realized Gains and Losses) Net Other Additions/ Deductions Net Position August31, 2013 Analysis of Net Other Additions and Deductions: Transfers Between Funds Designated Funds Auxiliary Enterprise Funds Restricted Funds Loan Funds Net Transfers Between Funds Total as Shown Above $ 951, , ,042, ,097, ,097, ~
165 Schedule B-7 Schedule of Changes in Net Position- Annuity and Life Income Funds As of August 31,2013 ->. 01 OJ ANNUITY AND LIFE INCOME FUNDS Held by System Administration Lundell CRUT Miller Thomas and Thelma CRT Alexander PIF Michener 1990 Charitable Trust Jacobs Gift Remainder Interest Surginer Family CRT Milburn Fam CRT Weller Edgar and Melanie CRT Gibbs Olivia Jeanette Leary Estate Got! Fund Langston CRT Gibbons Pool Income Sellers CRT Heinen CRT Gross CRT Fath C AND A CRT Dinino CRT Steinberg CRT Herskowitz CRT Crawford Charitable Trust Ward CRT Daniel CRT Fielder CRT Gonzalez-Gerth Gift Glickman CRT Uris Trust Sibley OJ JR. Remainder Interest Irwin CRT Hutsell Charitable Trust I Hutsell Charitable Trust II Kenneth Medlin CRUT Jean Andrews Charitalbe Remainder Annuity Tr Total Held by System Administration Net Position September 1, , , , , , , , Gift Additions to Annuity and Life 112, , , , ,782, , , , , ,318, , , , , , , , ,617, , Investment Income 2, , , , , (6.66) 1, , , , , , , , , , , , , Net Increase Investment Income Payments to Net (Decrease) in Fair (Realized Gains and Beneficiaries and Other Additions/ Net Position Value of Investments Losses) Annuitants Deductions August 31, , (4,632.51) 18, , , (4,341.63) 65, (2,962.78) , , , , (2,039.53) 40, , , (1,115.98) , (43,333.85) 1, , (6,887.37) 117, (48,473.89) 8,792,55 49, , (3,395.46) 51, (2,716.54) 80, (2,985.00) 1,929, (674.36) 17, (20,339.08) 287, (126,714.68) 57, , , , , (41,190.68) 155, , , (40,600.08) 216, , ,319, (69,451.30) (160,105.00) 824, , , (13,477.32) 117, (2,003.07) 18, (20,291.18) 382, (2,002.97) 18, (19,605.17) 301, (329.07) 1, (2,027.97) 22, , (64.64) (73,642.20) 449, (285,911.36) 245, (300,802.78) (43,333.85) 7,684, TOTAL ANNUITY AND LIFE INCOME FUNDS 7,617, , , (285,911.36) 245, (300,802.78) (43,333.85) 7,684, Analysis of Net Other Additions and Deductions: Transfers Between Funds Restricted Funds (43,333.85) Net Transfers Between Funds Total as Shown Above ( 43,333.85) $ (43,333.85)
166 Schedule B-8 Schedule of Changes in Net Position Unexpended Plant Funds For the Year Ended August31, 2013 Permanent University Fund Revenue Interest Earned On Total Bonds Bonds/Notes Gifts Construction Funds Other Sources AUF NET POSITION, September 1, 2012 $ 206,785, (1,045,326.52) 31,674, ,611, ,362, ,075, ,106, ADD: Anticipated Bond Proceeds 41,671, ,738, ,933, TOTAL NET POSITION, September 1, ,456, ,693, ,607, ,611, ,362, ,075, ,106, Additions: Investment Income 2,648, ,648, Net Increase (Decrease) in Fair Value of Investments 3,049, ,049, Transfers Between Funds- From Educational and General Funds 29,695, ,695, Transfers Between Funds- From Designated Funds 51,582, ,582, Transfers Between Funds - From Auxiliary Enterprise Funds 24,965, ,965, Transfers Between Funds- From Restricted Funds 20,066, ,457, , Transactions Between Funds (200,000.00) (200,000.00) Transfers from System Administration 20,950, , ,091, Total Additions 152,758, , ,091, ,457, ,697, ,156, ,695, Deductions: Op. Expenses: Materials, Supplies, and Services (Exh. B) 41,411, ,907, ,243, ,323, (16,274.49) 25,018, ,935, Capitalized Plant Facilities Land and Land Improvements 5,232, , ,932, Furniture and Equipment 5,432, ,694, ,002, , , , Other Depreciable (Including Library Books) 376, , Construction in Progress 136,346, ,268, ,632, ,828, ,566, ,492, ,557, Nonamortizable Intangible Assets 6,001, ,473, ,528, Total for Capitalized Plant Facilities 153,389, ,339, ,635, ,700, ,566, ,513, ,634, Total Deductions 194,801, ,247, ,878, ,023, ,549, ,532, ,570, Transfers Between Funds- To Educational and General Funds 724, , Transfers Between Funds- To Designated Funds 24,490, ,490, Transfers Between Funds- To Auxiliary Enterprise Funds 824, , Transfers Between Funds- To Restricted Funds 200, , , Transfers to System Administration 1,442, , , , Total Deductions 222,484, ,247, ,962, ,203, ,236, ,540, ,294, TOTAL NET POSITION, August 31, ,730, ,105, ,735, (14, 133,769.41) 12,823, ,692, ,507, LESS: Anticipated Bond Proceeds 27,629, ,381, ,248, NET POSITION, August 31, 2013 $ 151 '1 01, (2,276,400.65) 14,487, (14, 133,769.41) 12,823, ,692, ,507, Made Up As Follows: Unrestricted Capital Projects $ 153,023, Total Unrestricted 153,023, Restricted - Expendable Capital Projects (1,922,294.03) Total Restricted- Expendable (1,922,294.03) Total Net Position as Above $ 151 '1 01, ~ 01 -.J
167 -" 01 co The University of Texas at Austin Schedule B-11 Schedule of Changes in Investment in Plant For the Year Ended August 31,2013 Net Investment in Capital Assets, August 31, 2012 ADO: Accumulated Depreciation/Amortization,August 31, 2012 Notes and Loans Payable, Current Notes and Loans Payable, Noncurrent Lease Purchases Payable, Current Lease Purchases Payable, Noncurrent Historical Cost of Plant, September 1, 2012 Additions Capitalized Expenses and lnterfund Transfers: Capitalized Expenses- Educational and General Funds Capitalized Expenses- Designated Funds Capitalized Expenses- Auxiliary Funds Capitalized Expenses- Restricted Current Funds Capitalized Expenses- Unexpended Plant Funds Gifts for Capital Acquisitions Capitalized Lease Purchases Completion of Construction in Progress Proceeds from Sale of Capital Assets Inventory Adjustments Reclassification for Interagency Transfers In (Gain) Loss on Sale of Capital Assets Recog. in Oth. Funds Transactions Between Funds Other Additions (All items not specifically listed above) Total Additions Deductions Disposal of Capital Assets Completion of Construction in Progress Reclassification for Interagency Transfers Out Other Deductions (All items not specifically listed above) Total Deductions Historical Cost of Plant,August 31,2013 Accumulated Depreciation/Amortization, September 1, 2012 Reclassification for Interagency Transfers In- Accum. Depr. Reclassification for Interagency Transfers Out- Accum. Depr. Add: CY Depreciation/Amortization Deduct Disposal of Capital Assets Accumulated Depreciation/Amortization, August 31, 2013 Net Book Value of Capital Assets, August 31, 2013 Amortizable Facilities and Other Depreciable Nonamortizable Amortizable Internally Other Vehicles Nondepreciable (Including Library Construction In Intangible Purchased Developed Land Buildings Improvements Equipment & Aircraft Collections Books) Progress Infrastructure Assets Software Software Total S-11A S-118 S-11C S-110 S-110 S-110 S-110 S-11E S-11F S-11G S-11G S-11G 2,825,564, ,848, '720,439, ,768, ,850, ,980, ,298, ,566, ,559,062,14 16,579,858,91 3,209,455,00 103,850,714,52 1,611,240,58 2,346,094, ,373,557, ,242,982,34 414,914, ,124, ,387, ,767,834,20 120,304,410,43 8,795,605,91 1,066, ,066, ,359, ,359, ,284, , ,010, ,067, , ,206,731,39. _'jil ,193,436, ,731,522,10 3,093,997,241,99 341,011,918,13 573,246, ,105, ,712, ,954, ,559, ,347,693,11 3,209, ,155, ,406,846,49 6,670, ,118, , ,107, ,389,979,82 67,845,418,26 1,520, ,232, ,882, ,939,536,90 572, ,818, ,432, ,025,362,76 282,879,348,31 258,758, ,788, ,332,037,11 81,784,94 81,784,94 444, , ,947,236,74 3,324,498,98 169, , (364,870.83) (113, 125,00) (251,745.83) 58,740,02 523, , , ,094,939,55 379,182,58 917, ,865, ,520, (198,727.10) 13,692, ,025, ,389,979,50 _1,lll,490,03 605,120, , 118,938,18 258,758, ,788,356,75 117,995, ,194, ,761,004,07 3,350, ,655,605, , ,394,85 3,622, ,585, ,707,866,77 136,346,846,27 6,001,984,51 8,860,050,00 155,054,713,04 6,001,984,51 8,860,050,00 54,255,873,75 36,985, ,311,335,14 453,676,00 13,755, ,672,00 282,879,348,31 282,879, ,117,568,72 1,471, , , , ,416,159, ,850, ,352,756, ,800, ,452,647,33 26,946, ,019, ,539, ,394, ,347, ,211,439,51 197,167, ,672,174,49 2,346,094,931,45 NIA 1,373,557, ,242, ,914,963,75 16,124, NIA 227,387,483,60 NIA 39,767, ,304, ,795,605,91 2,872, NIA 2,872, NIA NIA (1,113,850.67) NIA (917,166,90) NIA NIA (196,683.77) 292,207, NIA 138,631, ,950, ,682, ,709, NIA 10,815,068,88 NIA 1,227,689,47 76,119, ,231,53 (49,055,513.50) NIA (1,711,754.70) (106,202.76) (31,576,630.82) (1, 154, ) NIA NIA (1,688.79) (13,755,382.82) (749,672,00) 2,591,005,925,54 NIA 1,510,476, ,087, ,976, ,679, NIA 238,202, NIA 40,993, ,471, ,118,165,44 2,825,153, ,850, ,842,279, ,713, ,476,310,63 7,266, ,019,866,68 65,337, ,394, ,353, ,211,439,51 14,696, ,009,05 Change in Capital Assets for the year: (22, 188,493.00) 5, 118,938,18 121,839,525,92 (3,055,812.72) 45,145, (714,033.76) 28,307, (229,606,67) (133, 164,486,84) (1,226,000.68) 6,001,984,51 (89, 154,335,90) (1,057,231.53) Adjustments for Net Position: Less: Notes and Loans Payable, Current Notes and Loans Payable, Noncurrent Lease Purchases Payable, Current Lease Purchases Payable, Noncurrent Total Adjustments for Net Position Net Investment in Capital Assets (Exh. A) 697, ,280, ,699, ,799, ,476, , ,000,00 770, , , ,230,768,64 697, ,280, ,379,443,97 1,118, ,475,702,93 2,803,676, ,080, ,842,279, ,713, ,245, ,266, ,544, ,337, ,394, ,353, ,211,439,51 14,696,378,62 554,009,05
168 Schedule B-13 Schedule of Transfers Between Funds For the Year Ended August 31, 2013 Transferred From Transferred To Educational and Total Transfers General Designated Auxiliary Restricted Enterprises Expendable Loan Funds Endowment And Similar Other Than St. Unexpended Plant Funds EDUCATIONAL AND GENERAL FUNDS Between Funds DESIGNATED FUNDS Between Funds AUXILIARY ENTERPRISE FUNDS Between Funds RESTRICTED EXPENDABLE FUNDS Between Funds LOAN FUNDS Between Funds 48,194, ,770, ,593, ,718, ,829, ,237, ,152, ,835, ,727, ,088, ,210, , , ,402, , , , ,842, ,695, ,582, ,965, ,066, ENDOWMENT & SIMILAR FUNDS Other than St. Between Funds 1, ,799, ANNUITY AND LIFE INCOME FUNDS Between Funds 43, , UNEXPENDED PLANT FUNDS Between Funds 26,240, , , , , Total Transfers Between Funds 452,853, ,443, ,334, ,315, ,505, , ,897, ,309, ~ (}1 <D
169 160 The University of Texas at Austin Schedule C-1 Tuition and Fees Revenue For the Year Ended August 31, 2013 Education and General Designated Auxiliary Enterprises Total Unrestricted TUITION AND FEES DETAIL Gross Statutory Student Tuition Gross Designated Tuition Gross Laboratory and Supplemental Fees Gross Mandatory Student Fees Gross Program and Course Related Fees Gross Optional Student Fees Discounts and Allowances $ 118,467, , (24,474,741.07) 354,531, ,364, ,640, (1 06,055,443.02) 44,674, (8,228,037.60) 118,467, ,531, , ,039, ,640, (138,758,221.69) Net Tuition and Fees $ 94,220, ,481, ,446, ,148,734.02
170 Schedule C-2 Schedule of Expenses by Object and Fund Group For the Year Ended August 31, 2013 EDUCATIONAL AND GENERAL Salaries and Payroll Related Cost of Goods Professional Fees Other Contracted Materials and Repairs and Rentals and Wages Costs Sold and Services Services Travel Supplies Utilities Communications Maintenance Leases Instruction $ 309,321, ,395, , ,039, , ,256, , , , Research 29,889, ,706, , , 729, , ,039, ,161, ,094, , Public Service 1 '175, , , , , , , , Academic Support 34,389, ,453, , , , ,658, , ,792, , , Student Services 12,983, ,020, , , , , , , , Institutional Support 30,415, ,678, , , , , , 764, , , Operations and Maintenance of Plant 894, , (4,860.21) 2, , , Scholarships and Fellowships 23,864, ,486, Total Educational and General 442,933, ,314, ,079, ,032, ,871, ,389, , ,724, ,970, ,098, DESIGNATED Instruction 67,651, ,637, (1,914.20) 1,735, ,124, ,690, ,411, , , 152, , ,469, Research 18,298, ,460, , , , ,829, ,740, , , ,445, , Public Service 21 '178, ,514, , ,867, ,476, ,207, ,127, , , , ,030, Academic Support 41,282, ,226, , ,870, ,637, ,023, ,064, , ,342, , , Student Services 16,654, , 152, , ,513, , ,632, , , , Institutional Support 35,925, ,822, , ,697, ,945, , ,176, ,740, ,137, ,629, , Operations and Maintenance of Plant 39,186, ,637, , ,694, , ,906, ,935, , ,937, , Scholarships and Fellowships 1,526, , , , Total Designated 241,702, ,45_5~677.50_ 2,1_37,863.@ ,65_ ,008, , 71,405._14 -~3,060, ,858, ,462, ,040, ,146, AUXILIARY ENTERPRISES Auxiliary Enterprises 98,798, ,978, ,877, ,497, ,271 ' ,222, ,608, ,169, ,987, ,668, ,320, Total Auxiliary Enterprises 98,798, ,978, ,877, ,497, ,271, ,222, ,608, ,169, ,987, ,668, ,320, RESTRICTED EXPENDABLE Instruction 44,198, ,334, (2,835.80) 4,814, ,639, ,422, ,834, , , , , Research 190,157, ,279, ,597, ,906, ,901, ,401, , ,549, ,413, , 794, Public Service 20,399, , 755, , ,588, ,069, ,491, ,630, , , (354,377.13) 361, Academic Support 13,698, ,020, , ,053, ,266, ,468, ,154, , , , , Student Services 1,220, , , , , , , , , Institutional Support 2,319, ,349, , ,922, , , , , , Operations and Maintenance of Plant 2, , Scholarships and Fellowships 3,435, , (20,038.43) 285, , , , , , , Auxiliary Enterprises 8,052, ,156, , , , , ,133, , , ,332, Total Restricted Expendable 283,481, ,583, , ,348, ,289, ,392, ,070, ~,5!)_9.67- g, 14,_45l.62 4,135, ,738, LOAN FUNDS Student Services Total Loan Funds PLANT FUNDS Operations and Maintenance of Plant (134,445.14) 3,614, ,816, , ,843, , ,266, , Depreciation and Amortization Total Plant Funds (134,445.14) 3,614, ,816, , ,843, , ,266, , TOTAL OPERATING EXPENSES (Exh. B) $ 1,066,781, ,332, Q,542, ,012, ,418, ,160, ,972, ,192, ,926, ,081, ,902, ~
171 Schedule C-2 Schedule of Expenses by Object and Fund Group For the Year Ended August 31, 2013 EDUCATIONAL AND GENERAL Federal Sponsored State Sponsored Program Program Pass-Through to Pass-Through to Printing and Claims and Scholarships and Depreciation and Other State Other State Other Operating Subtotal Operating Capital Asset Reproduction Bad Debt Expense Losses Fellowships Amortization 8o~ocies Expenses 8oeocies Expenses Purchases Total Instruction 181, , , ,784, , ,389, Research 59, , ,727, ,344, ,071, Public Service 4, ,969, ,039, Academic Support 237, , , ,522, ,658, ,181, Student Services 172, , ,390, , ,401, Institutional Support 34, ,330, ,920, (17,636.36) 51,902, Operations and Maintenance of Plant ' 158, ,158, Scholarships and Fellowships 24,080, ,431 ' ,431 ' Total ~ducational and General 689,08L8_1 24,:JZ2, ,422, ,905, ,670, ,576, >. 0) "' DESIGNATED Instruction 681, , ,880, ,769, , ,706, Research 134, , , ,985, ,433, ,418, Public Service 1 '189, , ,977, ,456, , ,513, Academic Support 680, , ,858, ,902, ,950, ,853, Student Services 272, ,004, ,869, ,532, (2,472,02) 33,530, Institutional Support 394, ,584, ,397, ,094, ,492, Operations and Maintenance of Plant 25, ,412, ,420, , ,069, Scholarships and Fellowships 28,696, , ,484, Total Designated 3,378, ,213, ,343, ,949, ,118, ,068, AUXILIARY ENTERPRISES Auxiliary Enterprises 1,451, , ,736, ,765, , ,383, Total Auxiliary Enterprises 1,451, , ,736, ,765, , ,383, RESTRICTED EXPENDABLE Instruction 559, ,764, ,710, ,766, ,431, ,096, ,527, Research 1,064, ,932, ,963, , ,479, ,039, ,515, ,554, Public Service 413, , , ,751, ,168, ,558, ,727, Academic Support 547, , , ,123, ,251, ,834, ,085, Student Services 67, ,066, ,127, ,127, Institutional Support 186, , ,744, , 728, , ,802, Operations and Maintenance of Plant 5, , , Scholarships and Fellowships 35, , , ,846, , ,854, Auxiliary Enterprises 164, ,328, ,878, , ,882, Total Restricted Expendable 3,037, ,961, ,692, , ,687, ,4 75, ,107, ,582, LOAN FUNDS Student Services 617, , , , Total Loan Funds 617, , , , PLANT FUNDS Operations and Maintenance of Plant 31, , ,411, ,411, Depreciation and Amortization 292,207, ,207, ,207, Total Plant Funds 31, ,207, , ,619, ,619, TOTAL OPERATING EXPENSES (Exh. B) 8,588, , ,724, ,207, ,692, , ,626, ,411,334, ,514, ,489,848,773.15
172 Expense Classification Summary For the Period Ending August 31,2013 Instruction Research Public Service Academic Sup Dt'l Operations and Student Services Institutional Support Maintenance of Plant Scholarships and Fellowships Auxilia!:l Enterprises Depreciation and Amortization Total Expenses Cost of Goods Sold $ (4,750.00) 1, , , , , (20,038.43) 18,090, ,542, Salaries and Wages , ,345, ,752, ,370, ,857, ,659, ,946, ,826, ,850, ,066,781, Payroll Related Costs , , ,591, ,700, ,432, ,849, ,890, ,918, ,135, ,332, Professional Fees and Services 6,971, ,469, ,582, ,285, , ,907, ,835, , , 734, ,012, Other Contracted Services 13,804, ,252, ,837, ,480, ,582, ,440, ,506, , ,203, ,418, Travel 8,913, ,071' ,723, ,831, ' 127, ,230, , , ,439, ,204. to Materials and Supplies 14,501, ,181, ,779, ,877, , ,407, ,753, , ,742, ,972, Utilities 77, , , , ,741, ,935, ,169, ,192, Communications 9,458, ,185, , ,574, ,962, ,325, , ,071, ,926, Repairs and Maintenance 1,708, ,953, (77,537.71) 1,420, , , ,207, , ,694, ,081, Rentals and Leases 2,397, ,369, , ,415, ,315, , ,218, , ,653, ,902, Printing and Reproduction 1.422, , ,606, ,465, i, , , , ,616, ,588, Bad Debt Expense , Cla1ms and Losses Scholarships and Fellowships 3,331, ,064, , , ,004, , ,027, , ,724, Depreciation and Amortization Federal Sponsored Program Pass-Through to Other State Agencies 1,710, ,963, , State Sponsored Program Pass-Through to Other State Agencies 554, ,207, ,207, ,692, , Other Operating Expenses 15,152, ,588, ,729, ,180, ,977, ,658, , , ,064, ,626, Total Operating Expenses ' 608,985, ,752, ,594, ,676, ,669,277.1 i 149,046, ,995, ,763, ,643, ,207, ,411,334, ~ Q) w
173 Agency University oftexas at Austin Schedule 1A For the Fiscal Year Ended August 31, 2013 ***Certified*** Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non..State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount... Ol.,. U.S. Department of AQriculture Direct Proarams: Plant and Animal Disease, Pest Control, and Animal Care Pass-Throuah From: , , , , Child and Adult Care F cod ProQram , , , Pass-Through From: Department of Anriculture , Cooperative Forestry Assistance , , Pass-Throu,qh From: Texas A&M Forest Service 576 9, Forest Health Protection , , , Pass-Throu!lh From: Texas A&M Forest Service 576 3, Totals- U.S. Department of Agriculture 55,55iL62 70,i s:r:i2.s7 125:i32.57 " 125: U.S. Department of Commerce Direct Programs: Coastal Zone Management Estuarine Research Reserves Pass-Throuah From: Coastal Zone Management Administration Awards Pass~Throunh From: General Land Office , , , , , , , Coastal Services Center , , Pass-Throu11h From: General Land Office , Totals- U.S. Department of Commerce 37 ; , o:21o.62 so::rm:s2'" '" - 66,216:62 ROTC Language and Culture Training Grants Direct Pro a rams: INST OF INTL EDUCATION/ NSEP-U UT-ARA INST OF INTL EDUCATION/ 2072-GO-UTA (449.30) (449.30) (449.30) (449.30) 227, , , , IPA , , , , UTA , , , , ~;~;;;g~%870ltrdtd 103, , , , (3,396.40) (3,396.40) (3,396.40) (3,396.40) Basic and Applied Scientific Research , , Basic and Aoolied Scientific Research , , Pass-Throu.qh To: Texas Southern Univers1ly Basic Scientific Research- Combating 1, , , , Weaoons of Mass Destruction Basic Scientific Research , , , ,594.60
174 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Totals- 226, , , , , : , U.S. Department of Housing and Urban Development Sustainable Communities Regional g~~~~~~~ea COUNCIL 755, , , , Plannina Grant Proaram UTA Sustainable Communities Regional CAPITAL AREA COUNCIL 243, , , , Plannina Grant Proaram OF GOVTSI Direct ProQrams: UTA BOISSEAU Economic Development Initiative-Special 124, , , , Project, Neighborhood Initiative and Miscellaneous Grants Totals- U.S. Department of Housing 998, , ,122, , , ,122, and Urban Development U.S. Department of the Interior Service Training and Technical Assistance 4, , , , (Generic Trainina) U.S. Geological Survey_ Research and 10, , , , Data Collection Totals- U.S. Department of the Interior 14, , ,91lo.o0 14, U.S. Department of Justice U.S. Department of Justice AUSTIN CITY OF/ UTA Direct ProQrams: OVW Technical Assistance Initiative , , , , Pass-Throuoh From: BulletoroofVest Partnershio Proaram , Pass- Throu_oh From: Governor- Fiscal 300 4, Totals- U.S. Department of Justice 4, , , , , , U.S. Department of Labor Direct ProQrams: Mine Health and Safety Grants , , , ,Q]2.75 Totals- U.S. Department of Labor 304, , , , U.S. Department of State U.S. Department of State U.S. Department of State U.S. Department of State INST OF INTL EDUCATION/ UTA INST OF INTL EDUCATION/ UTA MERIDIAN INTERNATIONAL CENTER/ 52, , , , , , , , , , , , SIZ CA054 Academic Exchange Programs- 76, , , , INST OF INTL EDUCATION/ Graduate Students UTA Academic Exchange Programs- 33, INST OF INTL EDUCATION/ ~ Scholars UTA
175 Schedule 1A Cont. ~ Ol Pass-Through Pass-Through Pass-Through Ol Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entitles Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentifling No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Direct ProQrams: Environmental and Scientific Partnerships , , and Proarams Publlc Diplomacy Programs for , , Afqhanistan and Pakistan Totals- U.S. Department of State 368, , , , , U.S. Department of Transportation U.S. Department of Transportation DTFH64-12-G U.S. Department of Transportation DTFH64-12-G , , U.S. Department of Transportation DTFH64-12-G , , , , U.S. Department of Transportation DTFH64-12-G , , , ,500,00 U.S. Department of Transportation DTFH64-12-G , , , U.S. Department of Transportation DTFH64-12-G , ,5QO,QP 1,50Q.OO Totals- U.S. Department of 82, , , , Transportation Library of ConQress Library of Congress ~;~~~~~~~;~~~~~;; 1, , , , M Totals- Library of Congress 1, , , , 1, National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration CALIF INST OF TECH/ SEARCH/EXTRATERREST RIAL INTELLIGENCE INS/ 91, , , , , , , , SC-1022 National Aeronautics and Space SPACE TELESCOPE 3, , , , Administration SCIENCE INST/ HST-E A Direct ProQrams: National Aeronautics and Space 41, , , , NNX09AJ33G Administration Science , , , , Science Pass- Throu.qh To: Texas A&M Engineering Experiment Station Science , , Pass-Throu.qh To: Prairie View A&M University Science , , , Pass-Throu.qh To: UnlversHy of Texas at El Paso 724 5, Science , , , Pass-Throu.qh To: University of Houston Science , , Pass- Throu_qh To: Lamar University Science , , , Pass- Throu.qh To: University of Texas Health Science 744 4, Center at Houston
176 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy!U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif:ting No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Science , , , Pass- Tl7rou.qh To: University of Texas at Tyler 750 7, Science , Pass- Throu.qh T a: Texas A&M University- Commerce , Science Pass- Tl7rou.oh To: UnfvecsHy of North Texas Science , , , Pass- Tl7rou.qh T a: University of Houston - Clear Lake Science Pass- Throu.qh To: University of Houston - Downtown Science , Pass-Throu.Qh To: State Preservation Board Education , , , , Cross AQency Support , ,960.63?35, ~~.960,63 Totals- National Aeronautics and 110, ,227, ,337, , , ,199, ,337, Soace Administration National Endowment For The Humanities National Endowment For The ~~~~~ 1 TIQUARIAN 41, , , , Humanities UTA Promotion of the 1, , , , Humanities_Federai/State Partnership HUMANITIES TEXAS/ Laura Bush 21st Century Librarian Prooram Direct ProQrams: ~~~VA~G~~~~10RNIAAT 0285GQA138 77, , , , Promotion of the Humanities_ Division of 32, , , , , Preservation and Access Promotion of the Humanities_Fellowships 39, , , , and Stioends Promotion of the Humanities_Office of , , , , Diaital Humanities Museums for America , , , , National Leadershio Grants , , , Pass-ThrouQh From: Promotion of the Humanities_Divislon of Preservation and Access Pass-Through From: University of North Texas 752 6, , , , Totals- National Endowment For The 6, , , , , , , Humanities National Science Foundation Computer and Information Science and 96, , , , ;~~6~:~g~ESEARCH Enoineerina C/F-E-007 Social, Behavioral, and Economic 18, , , , Sciences 075 ~Ss"r~{u~70RNAL RSCH/ ~ DG OJ -..J Direct Proorams:
177 Schedule 1A Cont. -" Ol Pass-Through Pass-Through Pass-Through 00 Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Pro g. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount National Science Foundation OC/ , Enqineerinq Grants , , , , Mathematical and Physical Sciences , , , , Geosciences , , , , Computer and Information Science and 287, , , , Enaineerina Biolooical Sciences , , , , Social, Behavioral, and Economic 16, , , , Sciences Education and Human Resources ,368, ,368, , ,199, ,368, Pass-Throuqh From: Mathematical and Physical Sciences , , , Pass- Through From: University of Texas at El Paso , Education and Human Resources , , , Pass-Throu_qh From: University of Texas at El Paso Totals- National Science Foundation 44, , ,998, ,157, , ,988, ,157, Environmental Protection Agency Direct Proqrams: Science To Achieve Results (STAR) Fellowshio Proaram Pass-Through From: , , , , Capitalization Grants for Drinking Water State Revolvina Funds Pass-Through From: Texas Commission on Environmental , Qualitv 16, , , Performance Partnership Grants , , , Pass- Throu_qh From: Texas Commission on Environmental 582 6, Qua/ltv Totals- Environmental Protection 23, , , , Aoencv Nuclear Reaulatory Commission U.S. Nuclear Regulatory Commission Scholarship and Fellowship Program Direct Proqrams: ~~~~C~~~~AST~g~~L NRC , , , , U.S. Nuclear Regulatory Commission 25, , , , Nuclear Education Grant Pro a ram U.S. Nuclear Regulatory Commission 125, , , , Scholarship and Fellowship Proqram Totals- Nuclear Regulatory 106, , , , Commission U.S. Department of EnerQY U.S. Department of Eneray SANDIA NATL LABS/ 38, , PO# ; CONTRACT AGTMNT U.S. Deoartment of Eneroy SANDIA NATL LABS/ 7, , U.S. Department of Eneray SANDIA NATL LABS/ 226, , , ,
178 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non~State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif:ting No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Office of Science Financial Assistance Proaram Fossil Energy Research and Develooment Direct Proqrams: ~~~M~:~~~OJS-URBANA (A0008) ~~~~~~RB~;~~;Es 976-KS-TXBEG 5, , , , , , , , U.S. Depa11ment of Enerqv DE-FE00/7710 6, , , , U.S. Deoartment of Enerov DE-FE00/ , Office of Science Financial Assistance 34, , , , Proaram Nuclear Energy Research, Development , , , and Demonstration Pass~Throuqh From: State Enerqy Proqram , , Pass-Throu.Qh From: Comptroller- State Energy Conservation Office Totals- U.S. Department of Energy 135, , , , , , U.S. Department of Education U.S. Department of Education ~~~~~~~~~;~~~~;NT 159, , , , DC-AM572 U.S. Department of Education NATL WRITING PROJECT 40, , , , CORP/ 02-TXII U.S. Department of Education WARWICK PUBLIC (131.34) (131.34) (131.34) (131.34) SCHOOLS - R\1 DC-RIDE04 ARRA- U.S. Department of Education RHODE ISLAND DEPT OF 1 '146, ,146, ,146, ,146, EDUCATION/ Fund for the Improvement of Education LBJ FDNI 23, , , , Direct Proqrams: UTAOB-818 U,S. Department of Education T195N , , , , National Resource Centers Program for 1,355, ,355, ,355, ,355, Foreign Language and Area Studies or Foreign Language and International Studies Program and Foreign Language,;,nrl.ll.r<:><:l ~f rlit:><:: l=t:>lln>m<::hin Prnnr<:lm National Resource Centers Program for 1, , , Foreign Language and Area Studies or Foreign Language and International Studies Program and Foreign Language ::~nrl.ll.rp::~.c:t1wlit:><::!=<:>llnwc::hin Prnnr::~m Pass-Throu_qh To: Universtly of Texas at San Antonio Overseas Programs -Group Projects 285, , , , , Abroad Overseas Programs- Doctoral 46, , , , Dissertation Research Abroad Rehabilitation Lana-Term Traininq , , , , Javits Fellowships , , ,374,00 224, Graduate Assistance in Areas of National 63, , , , Need Centers for International Business 253, , , , ~ Education (j) Assistive Technoloav , , ,157,00 697, , CD Lanauaqe Resource Centers , , ,133.53
179 Schedule 1A Cont. Pass-Through Pass-Through Agy/U From Agencies or From Non- Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Grantor!Prooram Title No. NSE Name/ldentifvino No. No. Amount Amount Amount Pass-Through Total PT From and Agy/ To Agencies or Pass-Through To Direct Prog. Univ Universities Non..State Entities Amount No. Amount Amount Expenditures Amount Total PT To and Expenditures Amount ~ --J 0 Special Education- Personnel 241, Development to Improve Services and Results for l::hilclren with Disabilities Special Education_ Technical Assistance 230, and Dissemination to Improve Services ;:Jnd RestJits far Children with Disabilities School Leadership , Pass-Throuqh From: 241, , , , , , ,970,99 657, Miqrant Education State Grant Proqram Pass-Throu.oh From: Texas Education Aaencv , , , , Gaining Early Awareness and Readiness for Underaraduate Proarams Pass-Through From: Texas Education Aaencv , , , , Mathematics and Science Partnerships Pass-Throu.Qh From: Texas Education A_qencv 701 9,588, ,588, ,792, ,795, ,588, Mathematics and Science Partnerships Pass-Through From: Texas Education Aaencv , Pass- Throu.qh To: Texas A&M Un!vers1~V 168, , , Mathematics and Science Partnerships Pass-Through From: Texas Education Aoencv ,422,11 Pass- Throu_qh To: University of Texas Medical Branch at Galveston 123, , , Mathematics and Science Partnerships Pass-Throuqh From: Texas Education Aoencv , Pass-Throu.qh To: Univers!lv of Houston 197, , , Mathematics and Science Partnerships Pass-Through From: Texas Education A.aencv , Pass- Throu.Qh To: Universi~Y of Texas at Dallas 119, , , Mathematics and Science Pat1nerships Pass-Through From: Texas Education Aaencv , Pass-Throu_qh To: Univers!lV of Texas at Brownsville 252, , Mathematics and Science Partnerships Pass-Throu.ah From: Texas Education A.oencv , Pass- Throu.Qh To: University of Texas at Tyler 343, , , Mathematics and Science Partnerships Pass-Throu.oh From: Texas Education Aaencv , Pass- Throu.qh To: Universl1v of North Texas 125, , , Mathematics and Science Partnerships Pass-Throu.oh From: Texas Education A.oencv , Pass- Throu.qh To: 101, ,575.90
180 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Universllv of Houston - Clear Lake , Mathematics and Science Partnerships , , Pass-Throu.qh From: Texas Education Aaencv Pass-Through To: Texas A&M International University , lmorovina Teacher Quality State Grants , , Pass-Through From: Texas Education Aoencv , Strivina Readers , , , Pass-Through From: Texas Education Aaencv , Colleoe Access Challenoe Grant Proaram , , Pass-Through From: Texas Higher Education Coordinating , Board ARRA- Education Jobs Fund (7,054.00) (7,054.00) ( Pass-Through From: Texas Education Aaencv 701 (7,054.00) Totals- U.S. Department of Education 14,019, ,370, ,850, ,240, ,580, ,878, , ,240, Scholarship Foundations Woodrow Wilson Center Fellowships in the Humanities and Social Sciences 85 _300 ~~R~DROW WILSON INTL , , , GREENEWWIC FELLOWSHIP Totals- Scholarship Foundations 44, , , , National Archives and Records Administration Direct Prourams: National Archives and Records ;~:;:~;;~~~gg; 1 199, , , , CL/N Administration National Archives and Records 89_000 ;~:::-12-C-0011 CL/N 48, , , , Administration Totals- National Archives and Records 247, , , , Administration U.S. Department of Health and Human Services Affordable Care Act (ACA) Personal 35, , , , Responsibility Education Program GARDEA SERVICES/ UTA Substance Abuse and Mental Health 11, , , , Services_Projects of Regional and MERCER UNIVI National Significance Diabetes, Digestive, and Kidney Diseases Extramural Research Direct ProQ rams: UT c~~l~~~~lse~?spital UTA U.S. Department of Health and Human 93 _000 ~~~-::09-M MOD Services Centers for Genomlcs and Public Health , , , Environmental Public Health and 17, , , , Emeroencv Resoonse _,. -.J _,.
181 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount ~ --.] N Environmental Health , , , , Oral Diseases and Disorders Research , , , Graduate Psychology Education Program 155, , , , and Patient Navigator and Chronic Disease Prevention Proaram Mental Health Research Grants , , , , Substance Abuse and Mental Health 550, , , , , Services_Projects of Regional and National Sionificance Substance Abuse and Mental Health 17, , , Services_Projects of Regional and National Sianificance Pass- Throu.qh To: Univers!ly of Texas - Pan American , Advanced Nursing Education Grant 19, , , , Proaram Alcohol Research Proarams , , , , Drug Abuse and Addiction Research 219, , , , Proorams Mental Health National Research Service 288, , , , Awards for Research Trainina Discovery and Applied Research for 165, , , , Technological Innovations to Improve Human Health Advanced Education Nursing Traineeships , , , , Nursina Research Cancer Research Manpower , , , Developmental Disabilities Projects of , , , , National Sianificance University Centers for Excellence in 554, , , , Developmental Disabilities Education, Resemr.h. ;:mrl Service ARRA- Trans-NIH Recove1y Act Research , , , , Suooort Mental and Behavioral Health Education 36, , , , and Trainina Grants Extramural Research Programs in the , , , Neurosciences and Neurological Disorders Allergy, Immunology and Transplantation 5, , , Research Pass- Throu.qh To: Texas Tech UniversiTy Health Sciences 739 5, Center Biomedical Research and Research 122, , , , Trainina Child Health and Human Development , , , Extramural Research Aqino Research , , , , Vision Research , , , Pass-ThrouQh From: Substance Abuse and Mental Health 18, , , Services~ Projects of Regional and National Sianificrmce Pass-Through From: Department of State Health Services , The Affordable Care Act: Centers for , , , Disease Control and Prevention_lnvestigations and Technical A.c;;.c;;i!'-;t::\nr.P Pass-Throu_qh From: Department of State Health Services ,508.96
182 Schedule 1A Cont. Federal Grantor/Pass-through CFDA Grantor/Proaram Title No. NSE Name/lc;!~Dtifying No. Pass-Through Agy/U From Agencies or niv Universities No. Amount Pass-Through From Non State Entities Amount Direct Program Amount Total PT From and Direct Prog. Amount Agy/ Univ No. Pass-Through To Agencies or Universities Amount Pass-Through To Non-state Entities Amount Expenditures Amount Total PT To and Expenditures Amount ARRA- State Primary Care Offices Pass-Through From: ' Department of State Health Services 537 3, Centers for Disease Control and Prevention- Affordable Care Act (ACA) Communities Puttina Prevention to Work Pass-Through From: Department of State Health Services , , , , Centers for Disease Control and Prevention -Affordable Care Act (ACA) Communities Puttina Prevention to Work Pass-Through From: Department of State Health Services , , Pass- Throu.qh To: Texas State University- San Marcos PPHF 2012: Community Transformation Grants and National Dissemination and Support for Community Transformation , , , r,r;mt~ Pass-Through From: Texas A&M AgriLife Extension Service , Foster Care Title IV-E Pass-Through From: Department of Family and Protective Services , , , HIV Prevention Activities_Health Deoartment Based Pass-Through From: Department of State Health Services , , ,759,04 258,759,04 Totals -U.S. Department of Health and Human Services 1, i , "''"''' '4: ,759,237.44, ~~~na: ~~~"5,553.7s2.4if ~ 5.759;23 7:44 U.S. Department of Homeland Security Assistance to Firefiahters Grant Pass-Through From: AUSTIN CITY OF/ UTA , Buffer Zone Protection Program (BZPP) Pass- Through From: Department of Public Safetv , , Totals -U.S. Department of Homeland Security U. S. Agency for International Develooment 10, ,oi5:o7 45, :'99iJ:1Ji 45: U. S. Agency for International Develooment Pass-Through From: University of Texas at San Antonio /UT , , , , Totals- U. S. Agency for International Development Research & Development Cluster 17, , 'ff038~66 '17: oj w
183 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non..State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount j>.. U.S. Department of AQriculture U.S. Department of Aariculture KAI LLC/ UTA U.S. Department of Agriculture UNIVERSITY OF 34, , , , BALTIMORE/ USDA-TX; UTA Agriculture and Food Research 64, , , , UNIV OF FLORIDA/ Initiative UF International Forestry Programs XERCES SOCIETY 16, , , , INVERTEBRATE CONSERVATION/ UTA Direct Proarams: Agricultural Research_Basic and Applied Research Grants for Agricultural , , , , , , , , Research Comoetitive Research Grants Agricultural and Rural Economic Research, 5, , , , Cooperative Agreements and Collaborations Forest Health Protection "' }1, , 31,676,?.t, ~J,fE 2? ~J Totals- U.S. Department of Agriculture i15, , , , , Aoriculture and Food Research Initiative , , , , I!t,??. U.S. Department of Commerce U.S. Department of Commerce 11.ooo ~~~~!'~~~T;g~~Ts 2006-NE-1464 UTA , , , , , U.S. Department of Commerce NANOELECTRONICS ( ) (1,461.72) (1,461.72) (1,461.72) RESEARCH CORP/ 2006-NE-1464 UTA (LOA) U.S. Department of Commerce NANOELECTRONICS 204, , , , RESEARCH CORP/ 2013-NE-2400 Coastal Zone Management 151, , , , Administration Awards ~~~p~~~~~ Measurement and Engineering ~~~~~URI UNIV OF SCI & (9.52) (9.52) (9.52) (9.52) Research and Standards ARRA- Measurement and Engineering 314, , , , , AMER SOC OF HEAT Research and Standards REFRIG & AIC ENG INC/ 1596-TRP ARRA- Measurement and Engineering UNIV OF CALIFORNIA..SAN 78, , , , Research and Standards DIEGO/ SUB Technoloav Innovation Proaram RUTGERS UNIV/ 86, , , , ;?0# ; OC#10223 Direct Proarams: U.S. Department of Commerce UTA ;/P , , , , Coastal Zone Management Estuarine 715, , , , Research Reserves Climate and Atmospheric Research , , , , Habitat Conservation , , Center for Sponsored Coastal Ocean 468, , , , , Research Coastal Ocean Proaram Measurement and Engineering Research 282, , , , and Standards Technoloav Innovation Proaram , , , ,
184 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Unlv Universities Non..State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Pass-Throuoh From: U.S. Department of Commerce , , , Pass~Throu.qh To: University of Texas at Dallas NANOELECTRON\CS 173, RESEARCH CORP/ 2006-NE-1464 UTAOB-596 Sea Grant Support , , Pass-Throur:th From: Texas A&M University , Coastal Zone Management Administration Awards Pass-Through From: General Land Office , , , , , Coastal Zone Management Administration 51, , , Awards Pass-Throu.qh To: UNIV OF NEW 51, Texas A&M AgriLife Research 556 HAMPSHIRE/ Totals- U.S. Department of Commerce 179, ,585, ,143, ,908, , , ,949,78i.o5 3,908, t2000 ~~~ICPT~~~NOLOGIES 19, , , , FCA TA-UNTX-0010 AEGIS TECHNOLOGIES 41, , , , GROUP INC/ 62-STTR-UTXA-0098; PO AL\ON SCIENCE & 135, , , , TECHNOLOGY/ SUB DP COHERENT NAVIGATION 73, , , , INC/ CN-STTR CREAREINC./ (12.02) (12.02) (12.02) (12.02) 62637; FA M-3144 CREARE INC./ 78, , , , EMERGENT SPACE 36, , , , TECHNOLOGIES INC/ UTA FABRICO TECHNOLOGY/ (165.81) (165.81) (165.81) (165.81) UTA FLORIDA STATE UN IV/ 425, , , , R0090S, LOA GENERAL DYNAMICS/ 96, , , , FA D- 5702/0004;LAMPS LOA 01 BEND GENERAL DYNAMICS/ 99, , , ESM GENEVA FDNI S U.S. Depa11ment of Defense GENEVA FDNI 5, , , S GENEVA FDN/ 11, , , , ~ S GENEVA FDNI , , , ()'! S TSNRP-03 MOD 1 GENEVA FDN/ , V
185 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount ~ ---J 0> GDVT OF ISRAEL- 58, , , , MINISTRY OF DEFENSE/ PO HIGH PERFORMANCE 1, , , , TECHNOLOGIES INC/ HPTi-PETTT-UTAUSTIN T06 HIGH PERFORMANCE (636.20) (636.20) (636.20) (636.20) TECHNOLOGIES INC/ HPT/-PETTT-UTAUSTIN T04 BY SP HIGH PERFORMANCE 110, , , , TECHNOLOGIES INC/ HPT/-PETTT-UTAUST/N T05;P0277 HORSTMAN INC.I , , , UTA HRL LABORATORIES LLCI 75, , , , U.S. Depa11ment of Defense U.S. Depa11ment of Defense HRL LABORATORIES LLCI DS SWA LTRDTD INST OF INTL EDUCATION/ NSEP-U UT-HIN INST OF INTL EDUCATION/ 241, , , , , , , , , , , , NSEP-U UT-ARA-A INST OF INTL EDUCATION/ NSEP-U UT-ARA- R12-P INST OF INTL EDUCATION/ NSEP-U UT-HIN-A INST OF INTL EDUCATION/ 4, , , , , , , , , , , , NSEP-U UT-HIN-D INTL BUSINESS MACHINES 4, , , , CORP/ W ; JACOBS TECHNOLOGY (1,717.25) (1,717.25) (1,717.25) (1,717.25) INC.I UTA JOHNS HOPKINS UNIV 37, , , , APPLIED PHYSICS LAB/ PRM HM0/77-12-C JOHNS HOPKINS UNIV , , , APPLIED PHYSICS LAB/ PRM HM0/77-12-C KITWARE INC./ , , , HROOII-08-C S3,PHASEII KNOWLEDGE BASED 26, , , , SYSTEMS INC/ UTA MASSACHUSETTS INST (3,923.49) (3,923.49) (3,923.49) (3,923.49) OF TECH/ MASSACHUSETTS INST 61, , , , OF TECH/
186 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Namelldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount NANOHMICS INC/ 20, , , , UTA NON-DISCLOSED (0.07) (0.07) (0.07) (0.07) SPONSOR/ EERL SALARY CLEARING ACCOUNT NORTHROP GRUMMAN/ 45, , , , UTA NVIDIA CORP/ (220.01) (220.01) (220.01) (220.01) UTA ; P OHIO STATE UN IV/ , , , ; PO# RF0/ OMEGA OPTICS/ , , OMEGA OPTICS/ UTA OMEGA OPTICS/ , , UTA I t OMEGA OPTICS/ (7.64) (7.64) (7.64) (7.64) UTA ; FA C-0052 OMEGA OPTICS/ 108, , , , UTA OMEGA OPTICS/ , , UTA OMEGA OPTICS/ 14, , , , UTA OMITRON INC./ (141.66) (141.66) (141.66) (141.66) UTAII OMITRON INC./ , , UTA PALO ALTO RSCH 106, , , , CENTER/ PARC;LTR OF INTNT DTD PENN STATE UNIV/ 155, , , , UTEXAS PPG INDUSTRIES INC/ 56, , , PRATI & WHITNEY/ 126, , AMD8 SANDIA NATL LABS/ SCIENTIFIC FORMING 23, , , , TECHNOLOGIES CORP/ UTA SELECT ENGINEERING 30, , , , SERVICES/ UTA SPECTRAL ENERGIES 187, , , , LLC/ STANFORD UNIVI 157, , , , A TEXAS HIGH ENERGY 113, , , , MATERIALS/ UTA SWA TX RESEARCH INST INC. 113, , , , AUSTIN/ F SC TX RESEARCH INST INC. 28, , , , J AUSTIN/ -..J F SC/533 UES CORP/ 13, , S
187 Schedule 1A Cont. Federal Grantor/Pass-through CFDA Grantor/Proaram Title No. NSE Name/ldentifvino No. Pass-Through Agy/U From Agencies or niv Universities No. Amount Pass-Through From Non~ Total PT From and State Entities Direct Program Direct Prog. Amount Amount Amount Pass-Through Agy/ To Agencies or Pass-Through To Total PT To and Univ Universities Non-state Entities Expenditures Expenditures No. Amount Amount Amount Amount, -..J 00 Basic and Applied Scientific Research UN IV OF COLORADO BOULDER/ CU-31539/PO UNIV OF MISSISSIPPI/ (P-R375)UM SUBCONTRACT NO UNIV OF NEW MEXICO/ F UN IV OF NOTRE DAME/ UTA YALE UNIV/ C11K ST CENTURY TECHNOLOGIES/ TCT BOSTON UNIV/ 11, , , , , , , , , , , , , , , , , , , , , , , Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Aoolied Scientific Research (FORMERLY GC208303NGE) FLORIDA STATE UNIV/ OSP# ; TBD FLORIDA STATE UNIV/ R00905 FLORIDA STATE UNIV/ R00905;LOA FLORIDA STATE UNIV/ R0/287 FLORIDA STATE UNIV/ R0/413 FLORIDA STATE UNIV/ R0/544 FLORIDA STATE UNIV/ R0/557 JOHNS HOPKINS UNIV/ JHU I_PRM N D6606 JOHNS HOPKINS UNIV/ JHU CL/N 2 JOHNS HOPKINS UNIV/ CLIN I PROJ R4T02 JHUIAPL JOHNS HOPKINS UNIV APPLIED PHYSICS LAB/ JHU _ TASK I PRM N D6606 MASSACHUSETTS INST OF TECH/ PO MIT NANOHMICS INC/ NAN1158UTAII , , , ,026, , , , , , , , , , , , , , , , , ,026, ,026, , , , , , , , , , , , Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research Basic and Applied Scientific Research NON-DISCLOSED SPONSOR/ 09-C-4111 I CLIN 123 NON-DISCLOSED SPONSOR/ 09-C CLIN 4 NON-DISCLOSED SPONSOR/ 09-C CL/N 5 NON-DISCLOSED SPONSOR/ 09-C CLIN , , , ,
188 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Namendentifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Basic and Applied Scientific Research NON-DISCLOSED 13, , , , SPONSOR/ TASK ORDER 0001 Basic and Applied Scientific Research NON-DISCLOSED 3,098, ,098, ,098, ,098, SPONSOR/ Basic and Applied Scientific Research NON-DISCLOSED 943, , , , SPONSOR/ Basic and Applied Scientific Research NON-DISCLOSED 3, , , , SPONSOR/ Basic and Applied Scientific Research NON-DISCLOSED 3,942, ,942, ,942, ,942, SPONSOR/ Basic and Applied Scientific ReSearch NON-DISCLOSED 392, , , , SPONSOR/ Basic and Applied Scientific Research NON-DISCLOSED 919, , , , SPONSOR/ Basic and Applied Scientific Research NON-DISCLOSED SPONSOR/ CL/N Basic and Applied Scientific Research NON-DISCLOSED SPONSOR/ CLIN Basic and Applied Scientific Research NON-DISCLOSED SPONSOR/ CL/N 2021 Basic and Applied Scientific Research NON-DISCLOSED SPONSOR/ CLIN 2001 Basic and Applied Scientific Research NON-DISCLOSED SPONSOR/ CLIN2011 Basic and Applied Scientific Research NON-DISCLOSED SPONSOR/ CL/N 2021 Basic and Applied Scientific Research NON-DISCLOSED SPONSOR/ CL/N 2031 Basic and Applied Scientific Research NON-DISCLOSED 20, , , , SPONSOR/ Basic and Applied Scientific Research NON-DISCLOSED SPONSOR/ Basic and Applied Scientific Research NON-DISCLOSED 44, , , , SPONSOR/ CL/N2001 Basic and Applied Scientific Research NON-DISCLOSED 10, , , , SPONSOR/ CL/N 2011 Basic and Applied Scientific Research NON-DISCLOSED 65, , , , SPONSOR/ Basic and Applied Scientific Research NON-DISCLOSED 80, , , , SPONSOR/ Basic and Applied Scientific Research NON-DISCLOSED 178, , , , ; SPONSOR/ < CLIN 3001 Basic and Applied Scientific Research NON-DISCLOSED 141, , , , SPONSOR/ CL/N 3011
189 Schedule 1A Cont.... Pass-Through Pass-Through Pass-Through OJ Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and 0 Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Basic and Applied Scientific Research NON-DISCLOSED 20, , , , SPONSOR/ CL/N 3021 Basic and Applied Scientific Research NON-DISCLOSED 49, , , , SPONSOR/ CLIN3001 Basic and Applied Scientific Research NON-DISCLOSED 298, , , , SPONSOR/ CL/N 3011 Basic and Applied Scientific Research NON-DISCLOSED 119, , , , SPONSOR/ CL/N3001 Basic and Applied Scientific Research NON-DISCLOSED 438, , , , SPONSOR/ CL/N 3011 Basic and Applied Scientific Research NON-DISCLOSED 870, , , , SPONSOR/ CL/N 3021 Basic and Applied Scientific Research NON-DISCLOSED 134, , , , SPONSOR/ CL/N 3001 Basic and Applied Scientific Research NON-DISCLOSED 112, , , , SPONSOR/ CL/N 3011 Basic and Applied Scientific Research NON-DISCLOSED 141, , , , SPONSOR/ CLIN 4001 Basic and Applied Scientific Research NON-DISCLOSED 55, , , SPONSOR/ CL/N 4011 Basic and Applied Scientific Research NON-DISCLOSED 25, , , , SPONSOR/ CL/N 4021 Basic and Applied Scientific Research NON-DISCLOSED 123, , , , SPONSOR/ CL/N 4001 Basic and Applied Scientific Research NON-DISCLOSED 42, , , , SPONSOR/ CLIN4001 Basic and Applied Scientific Research NON-DISCLOSED 7, , , , SPONSOR/ CL/N 4011 Basic and Applied Scientific Research NON-DISCLOSED 51, , , , SPONSOR/ CL/N 4001 Basic and Applied Scientific Research STANFORD UNIV/ 333, , , B AMD 05 Basic and Applied Scientific Research TECO-WESTINGHOUSE (5.51) (5.51) (5.51) (5.51) MOTOR COMPANY/ G000873; UTA ; HTSTFMPHI Basic and Applied Scientific Research TECO-WESTINGHOUSE 4, , , , MOTOR COMPANY/ G Basic and Applied Scientific Research UN IV OF CALIFORNIA- 39, , , BERKELEY/ 8156 Basic and Applied Scientific Research UNIV OF MINNESOTA/ 123, , , , Basic and Aoo!ied Scientific Research UNIV OF MISSISSIPPI/ 73, , , , Basic and Aoolied Scientific Research UNIV OF PENNSYLVANIA/ , Basic and Applied Scientific Research WOODS HOLE , , , OCEANOGRAPHIC INST/
190 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldenlifxing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Basic Scientific Research -Combating FDN APPLIED Weapons of Mass Destruction MOLECULAR EVOLUTI/ 30, , , , UTA/ Basic Scientific Research- Combating , , NEW YORK UNIVERSITY/ Weaoons of Mass Destruction UTA ; PI: DR. MAGUED ISKANDER Military Medical Research and ERNEST GALLO CLINIC 202, , , , Develooment ' AND RESEARCH CTR/ Military Medical Research and 141, , , , UNIV OF DELAWARE/ Develooment Basic Scientific Research CARNEGIE MELLON UNIV/ 122, , , , Basic Scientific Research MASSACHUSETTS INST 56, , , , OF TECH/ AMD 3 Basic Scientific Research MASSACHUSETTS INST 32, , , , OF TECH/ Basic Scientific Research UNIV OF CALIFORNIA- 174, , , , BERKELEY/ ; PO# Basic Scientific Research UN IV OF ILLINOIS-URBANA 104, , , , CHAMPAIGN/ Basic Scientific Research UN IV OF MARYLAND- 99, , , , COLLEGE PARK/ Basic Scientific Research UNIV OF SOUTH 50, , , , CAROLINA/ ; PO# FA35 Basic Scientific Research UN IV OF WASHINGTON/ 87, , , , The Language Flagship Grants to 665, , , , INST OF INTL EDUCATION/ Institutions of Hiaher Education NSEP-U UT-ARA The Language Flagship Grants to 243, , , , , INST OF INTL EDUCATION/ Institutions of Hiaher Education NSEP-U UT-HIN-O Basic, Applied, and Advanced Research 98, , , , in Science and Engineering SIKORSKY AIRCRAFT/ Uniformed Services University Medical Research Pro iects Air Force Defense Research Sciences Proaram SA-908NP Rev/sed/ :;;;~~b:ti;~~kson ; 2272; UTA BROWN UNIVERSITY/ PO#P , , , , , , , , Air Force Defense Research Sciences 110, , CALIF INST OF TECH/ Pmaram _... Air Force Defense Research Sciences GEORGIA INST OF 69, , ~ Proaram TECHNOLOGY/ RB848-G1 Air Force Defense Research Sciences GEORGIA TECH 24, , , , Proaram RESEARCH CORP/ RD446-S1
191 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non..State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount... 0> 1\) Air Force Defense Research Sciences GEORGIA TECH 32, , , , Proaram RESEARCH CORP/ RD451-S1 Air Force Defense Research Sciences MASSACHUSETIS INST 102, , , , Proaram OF TECH/ Air Force Defense Research Sciences 51, , , , OHIO STATE UNIV/ Proaram Air Force Defense Research Sciences 11, , , , RICEUNIV/ Proaram R15904AMDNo. 3 Air Force Defense Research Sciences 149, , , , STANFORD UNIV/ Proaram E Air Force Defense Research Sciences 190, , , , STANFORD UNIV/ Proaram E Air Force Defense Research Sciences 14, , , , UN IV OF MICHIGAN/ Proaram Research and Technology Development ~~~~~~~E~ EVOLUTI/ 6, , , , UTA Research and Technology Development INTL BUSINESS MACHINES 43, , , , CORP/ ; sow # Research and Technoloov Development PURDUE UNIV/ 236, , , , Research and Technology Development UNIV OF CALIFORNIA- 119, , , , BERKELEY/ ;PO# ;HR Research and Technology Development UNIV OF COLORADO - 11, , , , BOULDER/ ; PO# Research and Technology Development UN IV OF NORTH 80, , , , CAROLINA AT CHAPEL HILU Research and Technology Development UNIV OF NORTH 1, , , , CAROLINA AT CHAPEL HILU Direct Proarams: D 13PC , , , HDTRAI-12-C , , , , , HR C , , , HR00/1-12-C , , , ~;g:~~::-.z-0336/cln 69, , , , IPA Dtd , , , , NNX12AI23G 77, ~:;%14-06-G-0218 DO 615, , , , N G-0218/ , , , , :~r:;4-09-c-0187 LOA 44, , , , ~~~~;;-09-C , , , , ~g?~~:2~~~~o:.;~~~ 15, , , , N G , , , ,044.11
192 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Prooram Title No. NSE Namelldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount N000/4-11-G , , , , _CLN0001 ACN AA AB N000/4-11-G , , , , , , , , ooo ~fo,j~~~~~<;~o:;-oot N000/4-11-G , , , _000 ~%%%14-11-G0041 DO 181, , , , N000/ , , , N000/ , , , , N000/ , , , N , , , , , , , ~~~~::;;7;;200/RA ~fo:~~:;;.c;;~~ , , , , N D , ,437, ,437, ,437, _CLN 0001 ACN AA AB '::}% 2 ~~o::ag;~~n AA 22, , , , ~~~~~~~c;;~~ ,637:99 209, , , _000 ~:%%24-07-D , , , , ~fo:~~~~~c;;~~~~ , , , , N D , , , , _CLN0001ACNAA AB ':%% 2 ~~o::a;;~~n AA ~fo:~:o~~c;;~~ '::% 2 ~-:::a;;~~naa ~fo:~~~~~c;;~~ ':!%2~o:-:r:;~~N AA 1, , , , , , , , , , , , , , , , , , , N D , , , , _CLN 0001 ACN AA AB ':r:/~~o::ag;~~n AA 34, , , , ~f0:~~-:r~c;;~~ , , , , ~fo:~~~~~c;;~~~~ , , , , ~f0:~~-:r~c;;~~ , , , , :;::2~~o::a::~~N AA ~fo:~~~~~c;;~~ ~f0:~~~~~c;;~~ ':%~2~~:-:a;;~~N AA ~:%% 2 ~~o::a::~~naa ~fo:~~::;.c;;~~ ~f~~~~%:"%~~: ~fo:~~~~~c;;~~ , , , , , , , , , , , , , , , , , , , , , , , , OJ w 13, , , , , , ,913.60
193 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentifxing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount N D ,767, ,767, ,767, ,767, _CLN0001ACNAA AB N D , , , , _CLN0001 ACNAA AB ~f0:~~~~~~~~ , , , , ~f0:~~::~~~~ , , , , ~fo:~~:~~~~:t 138, , , , ~f0:~~~~~~~~ , , , , ~f0:~~:~~~~ , , , , ~f0:~~~~~~~~1~1i4 88, , , , N D , , , , _CLN0001ACNAA AB _CLN0001ACNAA AB N D , , , , ~fo:~~-:r~~~~ , , , , U.S. ~apartment of Defense ':J~% 2 ~~:-:o::~~n AA ~fo,j~~1t':;~~-:;o ~:~~ 2 ~~0:-:o::~~N AA ~f0:~~~~~~~~ ':J~%2~~o:-:o::~~N AA ~fo:~~-:r~~~~ ~f0:~~~~~~~~ ~f0:~~~~':;~~ ~f0:~~~~~~~ ~f0:~~~%~~~ , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~%~%~/:~~~ , P- 80, , , , ~f0:~~-:r~~~~ ~f0:~~~~~~~~ ':J%% 2 ~~0:-:ot:~~NAA 125, , , , , , , , , , , , , ~f0:~~:~~~~ , , , , ~%~%~/:~~~~ P- 420, , , , ~%~~2~~0:-g;g:oo-0485 P- 940, , , , ~f0:~~~~~~~~~~86 723, , , , ~fo:~~~o;::;~~ , , , , ~%~~2~~0:-g;g;oo-0488, P- 2,602, ,602, ,602, ,602, N D "'"
194 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy!IJ From Agencies or From Nan- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non...State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount 12.ooo '/:%% 2 ~tz-';;%:~~nm , , , '::%% 2 ~~o:-g;;;~~n M 10, , , , ~fo:~~~~c;;~~ ~::/~::-g;;:~~n AA ~fo:~~~o;;.c;;~~ , , , , , , , , N D ,606, ,606, ,606, ,606, ~fo:~~::~c;;~~ , , , ,732, AB 0498_CLN0001 ACNAA 12.ooo ~%~%2~~0:-';;;;oo p ~fo:~~~~~c;;~~ ~fo:~~~~c;;~~ ~fo:~~:~c:::~~ , , , , , , , , , , , , , , , ~fo:~~::~c;;~~ , , , , ~fo:~~::..c:::~~ ~fo:~~::~c:::~~ ~fo:~~:~c;;~~~~ob ~f0:~~~o;;.c;;~~~~ ~fo:~~~c;;~~ ~fo:~~:~c:::~~ ~fo:~~~o;;.c;;~~ , , , , , , , , , , , , , , , , , , , , , ~fo:~~:~c;;~~~~ ; , , , ~f0:~~~o;;.c;;~~~~ , , , , ~fo:~~~o;;.c;;~~ ~fo:~~~o;;.c;;~~ ~fo:~~:~c:::~~ ~fo:~~~o;~c;;~~ ~fo:~~~~~c;;~~ ~fo:~~~o;;.c;;~~ ~fo:~~:~c:::~~ ~fo:~~~o;;.~~~ ~fo:~~::~c:::~~ ~fo:~~:~c:::~~ ~fo:~~~o;;.c;;~~~~25 265, , , , , , , , , , , , , , , , , , , , , , , , , , , ~ 70, , , , co (11 193, , , , OOO N D , , , , CLN 0003 ACN AA
195 Schedule la Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non~ Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Namelidentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount ~ 0> ()) ~fo:~~~o;;.~~~ ~f0:~~-:;;,~~~-0s30 150, , , , , , , , ~fo:~~~o;;.~~~~;} , , ~fo:~~~o;;.~~~ ~f0:~~-:;;,~~~ ~f0:~~-::~~~~ ~f0:~~~~~~~~ , , , , , , , , , , , , , , , , ~f0:~~-:;;,~~~ , , , , ~f0:~~-:;;,~~~ , , , , ~f0:~~-:;;,~~~~: 3 142, , , , ~fo:~~-:;;,~::.~:s ~f0:~~~o;;.~~~-os ~f0:~~-:;;,~~~ ~fo:~~-:;;,o;~~ ~f0:~~-:;;,o;:;::;oss ~fo:~~~o;;.~~~ ~fo:~~~o;;.~~2:j; ~fo:~~~o;;.~~2:j; ~fo:~~~o;;.~~2:j; ~f~o~~~o;;.~~2:j; ~fo:~~~o;;.o;~~ ~f0:~~-:;;,~~~ ~fo:~~~o;;.~~~ ~fo:~~-:;;,o;~~ ~fo:~~-:;;,o;~~ ~fo:~~~o;;.~~~ ~f0:~~-:;;,~~~ ~f0:~~-::;,~~~ , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ~fo:~~~~~o;~~~7: 5 1,036, ,036, ,036, ,036, ~f0:~~~~~~~~~:: 2 606, , , , ~f0:~~-;;~~~~~:: 8 75, , , , ~f0:~~-::~~~/ ~f0:~~-::;,~~~ ~fo:~~~~~o;~~/ , , , , , , , , (140.68) (140.68) (140.68) (140.68)
196 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non~ Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount ~fc:~~;ft~'?;!~ , , , , ~fc::~~-:~'?;!~~: 7 28, , , , ~f0:~~~~~'?;!~/ ~f0:~~~~~'?;!~/ ooo ~fo,j~~~o~'?;!~/ ooo ~fo,j~~~o7~'?;!~i ~fc::~~~~~'?;!~/ ~fc::~~-:~'?;!~ ~fc::~~-:~'?;!~ ~fc::~~;ft~'?;!~/ ~fc::~~-:~'?;!~ , , , , , , , , , , , , , , , , , , , , ~fc:~~~~~'?;!~: 03 64, , , , U.S. D~partment of Defense ~f0:~~~~~'?;!~/ ~f0:~~-::-:;!~ , , , , ~f0:~~~~~'?;!~ , , , , ~fc::~~;ft~'?;!~/ ~fc::~~;ft~'?;!~/0408 3, , , , , , , , ~fc::~~-:~'?;!~ 1 0:,% ~fc::~~-:~'?;!~ , , , , ~fo:~~-:~'?;:.;:,xom 31, , , , ~fc::~~-:~'?;!~: , , , ~f0:~~~~~'?;!~/0415 1, , , , ~f0:~~~~~'?;!~ ~f0:~~~~~'?;!~ , , , , ~f0:~~~~~'?;!~/ ~fc::~~~~'?;!~/ ~f0:~~-:~'?;!~ ~fo:~~;ft~!~/ , , , , , , , , , , , , ~f0:~~~~~'?;!~ , , , , ~fc::~~~~~'?;!~/ , , , , ~fc:~~~~~'?;!~ , , , , , , , , _ ~f0:~~~~~'?;!~/ j ~f0:~~~~~'?;!~ , ~f0:~~~~~'?;:.;::;,:34 77, , ,302.59
197 Schedule 1A Cont. ->. Pass-Through Pass-Through Pass-Through 00 Agy/U From Agencies or From Non Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and 00 Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentifxing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount N C , , , UTA SAWYER 161, , , , OOO UTA , , , , (GEORGIOU) UTA EIIington 65, , , W5J9CQ-12-C , , _000 ;:~t;':o~::-p-0206 MOD 6, , , , DOO ;:~tx::o~::-p-0206 MOD DOD W81XWH-10-P-0100MOD 12, No. P W911NF , , , DOO ~://QX-07-D-0002DO ~://r;;~~-0002-do 12.ooo "://Z;~;ff-ooo2-oo 79, , , , W911SD-12-P W9115U-10-C , ,784, , W912HQ-10-C W912HQ-11-C , , , , W912HZ-10-C , , , _000 ~g;;;;z-1o-c-oo31 219, , , , , W912HZ-11-C W912HZ-12-P , , W912HZ-12-P , , , W912HZ , W9126G-09-P , , , , ooo ~0:09;0:;~~;~:oo CLJN ~o:/;o::-!~;~~00 CLIN ~~~9;o:;~~;~~OO CLIN ~~~g;o:;~~;~~oo CL/N ~~~~g_~~-o:ocl/n ~~~o;~g_~;;;::o CLJN 12_000 ~~~2;~:: CL/N 166, , , , , , , , , , , , , , , , , , ,078, ,078, ,078, ,078, _ 000 ~~~ CL/N 14, , , , , Pass- Through To: Texas A&M Engineering Experiment N D , Station 0482 CLN 0001 ACN M , , , Pass-Through To: Texas A&M Engineering Experiment N D CR , Station MS Flood Control Proiects , , , , Basic and Aoolied Scientific Research , , , ,880, Basic and Applied Scientific Research , , , Pass- Throu_qh To: Texas Tech University , Basic Scientific Research- Combating 3,073, ,073, , ,671, ,073, Weaoons of Mass Destruction Military Medical Research and 98, , , , Develooment Basic Scientific Research ,943, ,943, , ,370, ,943,590.67
198 Schedule la Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass~Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Pro g. Univ Universities Non~State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Basic Scientific Research , , , Pass-Throu.,qh To: University of North Texas , Basic, Applled, and Advanced Research in , Science and Enaineerina 114, Air Force Defense Research Sciences 4, ,843, , ,979, ,843, Proaram Air Force Defense Research Sciences 47, , Proaram 47, Pass- Throu.qh To: Texas A&M Engineering Experiment , Station Mathematical Sciences Grants Proqram , , , Research and TechnoloQy Development ,596, ,596, ,yp:us 1,899,295,85 ~. ~9, Totals- 23,084, ,107, ,191, , ,122, ,835, ,191, U.S. Department of Housing and Urban Development Sustainable Communities Regional g~p~~~\~~ea 44, , COUNCIL 44, , Plannina Grant Proaram UTA DUTHIE Totals- U.S. Department of Housing 44, , , , and Urban Development U.S. Department of the Interior U.S. Deoartment of the Interior AUSTIN CITY OF/ 27, , UTA ; AP U.S. Department of the Interior COLUMBIA UN IV/ 79, , , , (GG005955) U.S. Department of the Interior COLUMBIA UNIV/ 74, , , , (GG ) U.S. Department of the Interior NATL CTR FOR (5,853.67) (5,853.67) (5,853.67) (5,853.67) PRESERVATION TECH & TRNG/ MT NC-10 U.S. Department of the Interior TT GOVERNMENT 13, , , , SOLUTIONS/ D11PC20198; ; PO# Minerals Management Service (MMS) 95, , , , , Environmental Studies Program (ESP) UNIV OF ALASKA/ Cooperative Landscape Conservation U.S. Geological Survey_ Research and Data Collection Direct Pro!'lrams: UAF INTL CRANE FDN/ UTA UNIV OF ALASKA/ UAF , PO# FP , , , , , , , , U.S. Department of the Interior E12PX , , , U.S. Department of the Interior G09PX02173 I , , , U.S. Department of the Interior G12PX , , , U.S. Department of the Interior M10PC , , , U.S. Department of the Interior P11AC91270 MOD2 45, , , , U.S. Department of the Interior P12AC71329AMD2 (174.52) (174.52) (174.52) (174.52) U.S. Department of the Interior P12AC71330 MOD , , , , ~ U.S. Department of the Interior P13AC , , Alaska Coastal Marine Institute , , , (0 Minerals Management Se1vice (MMS) 1,896, ,896, , ' 182, ,896, Environmental Studies Proaram (ESP)
199 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through. Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and co Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures 0 Grantor/Program Title No. NSE Name/ldentifling No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount WaterS MART (Sustaining and Manage 96, , , , America's Resources for Tomorrow) Research Grants (Generic) , , Earthquake Hazards Reduction Prooram , , , , U.S. Geological SUivey_ Research and 120, , , , Data Collection National Cooperative Geologic Mapping 122, , , , Proaram National Geological and Geophysical Data 17, , , , Preservation Proaram Energy Cooperatives to Support the , , National Coal Resources Data System INCRDSl Pass-ThrouQh From: Cooperative Endangered Species Conservation Fund Pass-Through From: Parks and Wildlife Deoartment , , , , State Wildlife Grants , , Pass-Through From: Parks and Wildlife Deoartment Research Grants (Generic) , , , Pass-Through From: Parks and Wildlife Department , Coastal Impact Assistance Prooram , , , , Pass-Through From: General Land Office , Coastallmoact Assistance Proaram , Pass-Through From: Texas Commission on Environmental Qualitv Coastallmoact Assistance Prooram , , Pass-Through From: General Land Office , Pass~ Throu.qh To: Texas A&M University ~ Corpus Christi , National Center for Preservation Technoloav and Trainina Pass-Through From: Parks and Wildlife Deoartment , , , , Totals -U.S. Department of the Interior 479, , " 2:752, """"""3:545, ,880:74 825)57.80 "''"''2:szt:432:Y2"',,~,~, 3.54S:o71.26 U.S. Department of Justice PartE- Developing, Testing and 26, , , , Demonstrating Promising New URBAN INST THE/ Proorams 2010-MU-FX-0613; UTA-01 National Institute of Justice Research, 92, , , , Evaluation, and Development Project HOUSTON CITY OF/ Grants C74344/UTA PH II Pass-Through From: Violence Aoainst Women Formula Grants , , , Pass-Through From: Governor- Fiscal ,817.46
200 Schedule 1A Cont. Federal Grantor/Pass-through CFDA Grantor/Proaram Title No. NSE Name/ldentifvina No. Pass-Through Agy/U From Agencies or niv Universities No. Amount Pass-Through From Non State Entities Amount Direct Program Amount Total PT From and Direct Prog. Amount Agy/ Univ No. Pass-Through To Non-state Entities Expenditures Amount Total PTTo and Expenditures Amount Totals- U.S. Department of Justice 111, , :143:85 2:lo:i4:l:s5 23o;i4:l.ss U.S. Department of Labor U.S. Deoartment of Labor U.S. Department of Labor Trade Adjustment Assistance Community College and Career Tr;:~ininn (TAAC:C:C:T' ~r;:~ntf:: Workforce Innovation Fund Pass-Throuah From: ASPEN INST/ CREDIT CTR FOR EMPLOYMENT SECURITY EDUC & RSCH/ C A 11-UTRMC ~~:~g:;e7killed JOBS FOR THE FUTURE/ UTA/ , , , , , , , , , WIA Pilots, Demonstrations, and Research Proiects Pass-Throu.Qh From: Texas Workforce Commission , , , , H-1B Job TraininQ Grants Pass-Through From: University of Texas ate/ Paso , , , , Totals- U.S. Department of Labor , ''627: ~627:9BD.49"' --~~627:9so:49 U.S. Deoartment of State U.S. Department of State ;~~;IAN RES AND DEV 102, , , , Totals- U.S. Department of State C a2:'ss7.9o- 'To2:8s7:i)o -- ~m2~'affi1r~~"'''~1ofss7.9o U.S. Department of Transportation U.S. Department of Transportation U.S. Department of Transportation U.S. Department of Transportation U.S. Department of Transportation U.S. Department of Transportation U.S. Department of Transportation CTR FOR TRANSPORTATION AND THE ENVIRONMT/ GA CTRFOR TRANSPORTATION AND THE ENVIRONMT/ UTA IG CTRFOR TRANSPORTATION AND THE ENVIRONMTI UTA ; FL DESIGNLINE USA/ UTA NATL ACADEMY OF SCIENCE/ HR25-32 TRANSPORTATION & ENVIRONMENT CTR FOR/ 18, , , , , , , , , , , , , , , , , , , , , ,347,95 66, , , U.S. Department of Transportation U.S. Department of Transportation U.S. Department oftransoortation UTA TRANSPORTATION & ENVIRONMENT CTR FOR/ UTA AMD No. 01 TRANSTEC GROUP INC/ UTM8-022 TRANSTEC GROUP INC/ 15, ( ) 52, , ( ) 52, , , >- ( ) ( ) ~
201 Schedule 1A Cont. Pass~Through Pass-Through Pass-Through <.0 Agy/U From Agencies or From Non~ Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and N Federal Grantor/Pass~through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non~State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount UTA ; U.S. Department of Transportation UNIV OF CALIFORNIA AT 35, , , , SANTA BARBARA/ KK1228 U.S. Department of Transportation UNIV OF CALIFORNIA AT 27, , , , SANTA BARBARA/ KK/228 Mod 02 Capital Assistance Program for CTR FOR 27, , , , Reducing Energy Consumption and TRANSPORTATION AND Greenho11se G:::1r; Fmissinns THE ENVIRONMT/ UTA Direct Proorams: U.S. Depa11ment of Transportation 20 _ 000 ~TFH61-07-H AMD 95, , , , Hiohwav Trainlno and Education (3,017.89) (3,017.89) ( ) ( ) Pass-Throuoh From: University Transportation Centers Program , , , Pass- Through From: Texas A&M Transportation Institute , Totals- U.S. Department of 865, , , ,261, , ,241, ,26( Transportation Office of Personnel Manaoement Office of Personnel Manaoement SIGMA TECH INC./ 3, , , S/G-11-0PM-0003; ORDER #00068; TASK #1.5 Totals- Office of Personnel 3, , , , ManaQement General Services Administration General Services Administration GENERAL DYNAMICS/ 314, , , GSA-ML-SC ESM General Services Administration GENERAL DYNAMICS/ 324, , , , G ; PO FXK Totals~ General Services 639, , Administration Library of Conqress Direct ProQrams: Library of Congress CRS# (10.36) (10.36) (10.36) (10.36) Totals~ Library of Congress (10.36) (10.36) (10.36) (10.36) National Aeronautics and Space Administration National Aeronautics and Space 8, , , , DOO ~~~~~~~~~~LUTE Administration UTA National Aeronautics and Space BALCONIES 64, , , , Administration TECHNOLOGIES LLCI UTA National Aeronautics and Space BALCONIES 35, , , , Administration TECHNOLOGIES LLC/ UTA National Aeronautics and Space CALIF INST OF TECH JET 123, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 31, , , , Administration PROPULSION LAB/
202 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Pro g. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount National Aeronautics and Space CALIF INST OF TECH JET , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 27, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 45, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 9, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 22, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 12, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 78, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET (3,441.70) (3,441.70) ( ) ( ) Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 13, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 72, , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 26, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 11, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 48, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 19, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 40, , , , Administration PROPULSION LAB/ Natlonal Aeronautics and Space CALIF INST OF TECH JET 9, , , , Administration j:~~~~sion L\IB/ National Aeronautics and Space CALIF INST OF TECH JET 40, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 4, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 15, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 26, , , , Administration PROPULSION LAB/ ~ National Aeronautics and Space CALIF INST OF TECH JET 6, , , , <0 Administration PROPULSION LAB/ "' National Aeronautics and Space CALIF INST OF TECH JET 59, , , , Administration PROPULSION LAB/
203 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through. Agy/U From Agencies or From Non- T otat PT From and Agy/ To Agencies or Pass-Through To Total PT To and <.0 -!>. Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non~State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount National Aeronautics and Space CALIF INST OF TECH JET 14, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 60, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 164, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 183, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 50, , , , Administration PROPULSION LAB/ National Aeronautics and Space CALIF INST OF TECH JET 30, , , , Administration PROPULSION LAB/ National Aeronautics and Space CHANDRA X-RAY Administration OBSERVATORY CTR/ G X National Aeronautics and Space EMERGENT SPACE 10, , , , Administration TECHNOLOGIES INC/ UTA National Aeronautics and Space 8, , , , ITHACA COLLEGE/ Administration UTA National Aeronautics and Space MICRO AEROSPACE 14, , , Administration SOLUTIONS INC./ UTA National Aeronautics and Space NATL INSTITUTE OF 65, , , , Administration AEROSPACE/ TI UTEX TASK# 6322-UTEX National Aeronautics and Space NATL INSTITUTE OF 6, , , , Administration AEROSPACE/ TI UTEX; TASK# 6304-UTEX National Aeronautics and Space NATL INSTITUTE OF 31, , , , Administration AEROSPACE/ T/ UTEX T.0.#6515UTEX National Aeronautics and Space 4, , , , OREGON STATE UNIV/ Administration NS226A-A National Aeronautics and Space PC KRAUSE & 24, , , , Administration ASSOCIATES INC/ PCK-UTA2012NNX39P National Aeronautics and Space RIO GRANDE VALLEY 24, , , , Administration SCIENCE ASSOC./ RGVSA-TX National Aeronautics and Space 25, , , , SMITHSONIAN INST/ Administration 10-SUBC-440- DODO ;UTA National Aeronautics and Space SOUTHWEST RES INST/ Administration D99059JD National Aeronautics and Space 49, , , , SOUTHWEST RES INST/ Administration E99046JD National Aeronautics and Space SPACE TELESCOPE 19, , , , Administration SCIENCE INST/ HST-AR A National Aeronautics and Space SPACE TELESCOPE Administration SCIENCE INST/ HST-AR-1261Z02-A
204 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif:ling No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount National Aeronautics and Space SPACE TELESCOPE 1, , , , Administration SCIENCE INST/ HST-AR A National Aeronautics and Space SPACE TELESCOPE 20, , , , Administration SCIENCE INST/ HST-AR A National Aeronautics and Space SPACE TELESCOPE 58, , , , Administration SCIENCE INST/ HST-AR A National Aeronautics and Space SPACE TELESCOPE 7, , , , Administration SCIENCE INST/ HST-E A National Aeronautics and Space SPACE TELESCOPE 15, , , , Administration SCIENCE INST/ HST-E A National Aeronautics and Space SPACE TELESCOPE 7, , , , Administration SCIENCE INST/ HST-E National Aeronautics and Space SPACE TELESCOPE Administration SCIENCE INST/ HST-G A National Aeronautics and Space SPACE TELESCOPE , , Administration SCIENCE INST/ HST-G A AMD 2 National Aeronautics and Space SPACE TELESCOPE Administration SCIENCE INST/ HST-G A National Aeronautics and Space SPACE TELESCOPE 19, , , , Administration SCIENCE INST/ HST-G A National Aeronautics and Space SPACE TELESCOPE 5, , , , Administration SCIENCE INST/ HST-G A National Aeronautlcs and Space SPACE TELESCOPE 4, , , , Administration SCIENCE INST/ HST-G A National Aeronautics and Space SPACE TELESCOPE Administration SCIENCE INST/ HST-HF A National Aeronautics and Space UNIV OF CALIFORNIA AT 87, , , , Administration LOS ANGELES/ 2090-S-NBS/5 National Aeronautics and Space UNIVERSITIES SPACE 1, , , , Administration RESEARCH ASSOCi NAS Science 8, , , , g~~~~~~~~~~tr/ G X Science COLUMBIA UNIV/ 29, , , , I(Acct# ) Science SOUTH DAKOTA STATE 17, , , , UN IV./ 3TB 135/EUGEN/0 ARIMA Science UNIV OF NEW MEXICO/ 104, , , , V-874F SUBAWARD PRIME NNXt IAG91G Science UNIVERSITIES SPACE 22, , , , RESEARCH ASSOCi Science UNIVERSITY OF 46, , , , MARYLAND BALTIMORE COUNTY/ 7336 Science WOODS HOLE 85, , , , OCEANOGRAPHIC INST/ A/00911 CD (]1
205 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through... Agy/U From Agencies or From Non~ Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and co Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures 0"> Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Aeronautics Direct Proarams: 43_002 ~~~Lg~~OLORADO- 2, , , , ; SPO# National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration National Aeronautics and Space Administration NAS AMD NNC09CAOBC NNC13VB83P ~:o~;rz~c PR # ~':o~:o~~itc PR# NNXOBAD58G NNXOBAJ84G NNXOBAN02G NNXOBAN68G NNX08A052G NNX08A052G NNXOBAR34G NNXOBA T06G NNXOBAWOBG NNX09AB30G NNX09AD85G NNX09AE46G NNX09AG20G NNX09AH48G NNX09AJ48G NNX09AK7SG NNX09AM51A NNX09AM60G NNX09ANIOG NNX09AVIOG NNX09AW26G NNXIOAC68G NNXIOAFIOG NNX10AG20G NNXIOAH28G NNXIOAK82H 3,082, ,082, , ,903, ,082, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,923.66
206 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentifling No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount National Aeronautics and Space 47, , , NNX10AM31G Administration National Aeronautics and Space ~~~10A026G 09-MDAP09-108, , , , Administration National Aeronautics and Space 80, , NNX10AP98G Administration 80, National Aeronautics and Space , , , NNX12AG09G Administration 91, Science ,438, ,438, ,574, ,864, ,438, Science , , Pass~Throu.qh To University of Texas at San Antonio Science , , , Pass-Throuqh To: Texas A&M University- Corpus Christi , Education , , , Cross Aqencv Support , , , , Pass-ThrouQh From: Science Pass-Through From: Texas Tech University Totals- National Aeronautics and ,321, ,657, ,979, , ,825, i3,o91, ,979, Space Administration National Endowment For The Humanities Laura Bush 21st Century Librarian Prooram Direct Proorams: ~~~~Ao;y ~~~~y~e~~d RE , , , , Promotion of the Arts_ Grants to Oraanizations and Individuals Promotion of the Humanities Research , , , , Promotion of the Humanities_ Office of (274.19) (274.19) (274.19) (274.19) Diaital Humanities Laura Bush 21st Century Librarian 154, , , , Proaram Pass-ThrouQh From: Grants to States , , , Pass-Through From: Texas State Library and Archives , Commission Totals- National Endowment For The 15, , , , , Humanities National Science Foundation National Science Foundation AMER EDUC RES ASSOI 6, , , , UTA National Science Foundation CONSORTIUM FOR 8, , , , OCEAN LEADERSHIP/ T317A59 Task Order National Science Foundation CONSORTIUM FOR OCEAN LEADERSHIP/ T330A59 National Science Foundation CONSORTIUM FOR 7, , , , OCEAN LEADERSHIP/ ~ T338A59 National Science Foundation CONSORTIUM FOR 32, , , , OCEAN LEADERSHIP/ T National Science Foundation CONSORTIUM FOR 12, , , OCEAN LEADERSHIP/ CD -.J
207 Schedule 1A Cont. Federal Grantor/Pass-through CFDA Grantor!Prooram Title No. NSE Name/Identifying No. Pass-Through Agy/U From Agencies or niv Universities No. Amount Pass-Through From Non State Entities Amount Direct Program Amount Total PT From and Direct Prog. Amount Agy/ Univ No. Pass-Through To Agencies or Universities Amount Pass-Through To Non-state Entities Amount Expenditures Amount Total PT To and Expenditures Arn2YJ!L.. (0 00 National Science Foundation National Science Foundation National Science Foundation National Science Foundation Engineering Grants T343A59 INDIANA UNIV/ /UB UTA; PO# INTEGRATED OCEAN DRILLING PROG./ /ODP-M/ STEVENS INSTITUTE OF TECHNOLOGY/ 7170 UTA WOODS HOLE RSCH INST./ WHRC-MG CARNEGIE MELLON UNIV/ , , , (34.36) 233, , , , (34.36) , , , (34.36) 233, , , , (34.36) Enoineerino Grants Enoineerino Grants Engineering Grants Enoineerino Grants Engineering Grants Enoineerino Grants Enoineerino Grants Enaineerino Grants Enoineerinq Grants Engineering Grants Engineering Grants Mathematical and Physical Sciences CORNELL UN IV/ LA#003 CORNELL UNIV/ GEORGIA INST OF TECHNOLOGY/ R8009-G1 MESA PHOTONICS/ UTA NORTHEASTERN UN IV- BOSTON/ OMEGA OPTICS/ UTA PURDUE UNIV/ NEES PURDUE UNIV/ NEES SENTINEL PHOTONICS/ UTA VIRGINIA TECH UNIVERSITY/ VIRGINIA TECH UNIVERSITY/ g~~~~~s~~~~~rsity/ , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , DMR ; UTA Mathematical and Physical Sciences Mathematical and Physical Sciences Mathematical and Physical Sciences Mathematical and Physical Sciences Mathematical and Physical Sciences Mathematical and Physical Sciences Mathematical and Physical Sciences CASE WESTERN RESERVE UNIVERSITY/ DMR ; UTA BONNECAZE CASE WESTERN RESERVE UNIVERSITY/ DMR ; UTA ELLISON COLUMBIA UN IV/ 1 (GG009299) PRINCETON UNIV/ 1591 PRINCETON UNIV/ 1884 PRINCETON UNIV/ 1885 UN IV OF COLORADO- BOULDER/ 51, , , , , , , , , , , , , , , ; PO# Mathematical and Phvsical Sciences Mathemalical and Physical Sciences UNIV OF MICHIGAN/ UNIV OF MICHIGAN/ 31, , , , , , ,653.92
208 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Proqram Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Mathematical and Physical Sciences UNIV OF WISCONSIN/ K763 Mathematical and Physical Sciences WESLEYAN UNIVERSITY/ FRS Geosciences COLUMBIA UNIV/ (GC002456) Geosciences CONSORTIUM FOR (227.97) (227.97) (227.97) (227.97) OCEAN LEADERSHIP/ SA12-13 Geosciences CONSORTIUM FOR , OCEAN LEADERSHIP/ T341A59 Geosciences UNIV OF MINNESOTA/ , , Geosciences UNIV OF SOUTHERN 17, , , , CALIF/ Computer and Information Science and 19, , , , ;~~;~:~g~esearch Enaineerina C/F-D-007 Computer and Information Science and UNIV OF COLORADO- 80, , , , Enaineerina BOULDER/ I Biological Sciences 12, , , , ~~~~R~~~~~~o~~' NYBG UT Bioloaical Sciences INDIANA UNIV/ , , , BL UTA; PO# Bioloaical Sciences MICHIGAN STATE UNIVI 468, , UT Biological Sciences NORTH CAROLINA STATE 115, , , , UNIVERSITY/ Bioloaical Sciences UN IV OF ARIZONA/ 1.695, , , , Y Bio/oqical Sciences UN IV OF CAL-RIVERSIDE/ 1, , , , S Bio/oqical Sciences UNIV OF MINNESOTA/ 191, , , , H00/ Bioloqical Sciences UNIV OF MINNESOTA/ 79, , , H Social, Behavioral, and Economic CARNEGIE MELLON UNIV/ 1, , , , Sciences Social, Behavioral, and Economic GALLAUDET UNIVERSITY/ 8, , , , Sciences Social, Behavioral. and Economic Sciences Social. Behavioral. and Economic Sciences Education and Human Resources ; UTA RAND CORP/ YALE UNIV/ C09D ~~~~~~~~~~~ERN SP PROJ , , , , , , , , , , , , Education and Human Resources UNIV OF ILLINOIS- 130, , , , CHICAGO/ International Science and Engineering <D 47 _079 ~~~71AN RES AND DEV 4, , , , <D!OISE) ESPI-7030-TR-11 International Science and Engineering RENSSELAER 94.23" , , , (OISE) POLYTECHNIC INST/
209 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through N Agy!U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and 0 0 Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non..State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Office of Cyberinfrastructure Office of Cyberinfrastructure ~~~~~y~ GEOLOGICAL NSF UT; PO #BGS/3262 CARNEGIE MELLON UNIV/ 5, , , , , , , , Office of Cyberinfrastructure SAN DIEGO STATE 2, , , , UNIVERSITY/ 55291A7802 Office of Cvberinfrastructure UNIV OF CHICAGO/ (39.93) (39.93) (39.93) (39.93) K Office of Cvberinfrastructure UN IV OF GEORGIA/ , , RR/ Office of Cyberinfrastructure UNIV OF ILLINOIS-URBANA 162, , , , CHAMPAIGN/ Office of Cyberinfrastructure UN IV OF ILLINOIS-URBANA (526.53) (526.53) (526.53) (526.53) CHAMPAIGN/ ; GRANT CODE:A2685 Office of Cyberinfrastructure UNIV OF ILLINOIS-URBANA 3,941, ,941, ,941, ,941, CHAMPAIGN/ ;/LL/NOIS GRANT CODE: A 1536 Office of Cyberinfrastructure UNIV OF ILLINOIS-URBANA 90, , , , CHAMPAIGN/ ; ILLINOIS GRANTCODE:A/101 Office of Cyberinfrastructure UNIV OF NORTH 7, , , CAROLINA AT CHAPEL HILL/ Office of Cyberinfrastructure UNIV OF SOUTHERN 39, , , , CALIF/ i/0341 Office of Cyberinfrastructure UTAH STATE UN IV/ , ARRA- Trans-NSF Recovery Act 62, , , CARNEGIE MELLON UNIV/ Research Suooort ARRA- Trans-NSF Recovery Act 9, , , , INDIANA UNIV/ Research Suooort /UB UT ARRA- Trans-NSF Recovery Act 84, , , , TULANE UNIV/ Research Suooort TUL ARRA- Trans-NSF Recovery Act 216, , , , UN IV OF FLORIDA/ Research Suoo011 UF/2066 ARRA- Trans-NSF Recovery Act 37, , , , UNIV OF WASHINGTON/ Research Suooort Direct Pror.~rams: National Science Foundation DMR (/PA} 167, , , , National Science Foundation /S , , National Science Foundation ~~~15451/P AMD 9, , , , Enqineerlnq Grants , , , , Mathematical and Physical Sciences , , , ,669, ,890, Geosciences , , , , , Computer and Information Science and 7,966, ,966, , ,928, ,966, Enaineerlna Bioloaical Sciences , , ,875, ,688, Bioloqical Sciences , , , Pass- Throu_qh To: Sam Houston State University ,814.40
210 Schedule 1A Cont. Pass-Through Pass-Through Agy/U From Agencies or From Non- Federal Grantor/Pass-through CFDA niv Universities State Entities Grantor/Proaram Title No. NSE Name/ldentifvino No. No. Amount Amount Direct Program Amount Pass-Through Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Amount No. Amount Amount Amount Amount Social, Behavioral, and Economic Sciences Education and Human Resources Polar ProQrams International Science and Engineering (OISEl Office of Cvberinfrastructure Office of Cvberinfrastructure Pass- Throu_qh To: University of Texas at 1 Paso , ,034, , , , ,000, , ,922, ,000, ,034, , ,027, ,034, , , , ,100, , ,186, ,100, , , , ARRA- Trans-NSF Recovery Act Research Suooort Pass-ThrouQh From: ,684, ,684, , ,977, ,684, Geosciences Pass-Through From: University of Houston , , , , Education and Human Resources Pass- Throu.Qh From: Universltv of Texas at 1 Paso , , , , ARRA- Trans-NSF Recovery Act Research Suooort Pass-Through From: Texas A&M Engineering Experiment Station , , , ARRA- Trans-NSF Recovery Act Research Suooort Pass-Through From: University of Texas at San Antonio , , , , Totals- National Science Foundation "146, i 1:57:3, oo:s1T937:i2 42.i79:11". s:i4o.787:2r ss:42a:37t:j:r - 1oo:sTi.9:i7:72 U.S. Department of Veterans Affairs Direct Programs: U.S. Department of Veterans Affairs 64_000 ~~;~::-0859 VA , , , , U.S. Department of Veterans Affairs 64_000 r:,~ D , , , , U.S. Department of Veterans Affairs /PA 24, , , , Totals -U.S. Department of Veterans Affairs Environmental Protection Aoencv 193, ;io9:23 193, ii3,7o9.23 Environmental Protection Agency Environmental Protection Agency Direct Programs: OKEANOS TECHNOLOGIES LLC/ UTA PEGASUS TECHNICAL SERVICES/ PO#UTX ;EP-C ; WA , , , , , , Gulf of Mexico ProQram Science To Achieve Results (STAR) Research Proaram P3 Award: National Student Design Comoetition for Sustainabilitv Regional Applied Research Efforts (RARE) , , , , ,617,99 91, ,619, , , ,619, , , , ~ "' Pass~Throuah From:
211 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Prooram Title No. NSE Name/Identifying No. No. Amount Amount A_rnount Amount No. Amount Amount Amount ---- Am_o_unt N ~ Water Pollution Control State, Interstate, and Tribal Proaram Suooort Pass-Throu_qh From: Texas Commission on Environmental Qualitv , , , , Nonooint Source Implementation Grants Pass-Through From: Texas A&M AnriLife Research , , Nonooint Source lmolementation Grants Pass-Through From: Texas Commission on Environmental Qua/itv , , Capitalization Grants for Drinking Water State Revolvino Funds Pass-Through From: Texas Commission on Environmental Qua/ltv , , , , Science To Achieve Results (STAR) Research Proaram Pass~ Through From: UniversitY of Houston , , Performance Partnership Grants Pass-Through From: Texas Commission on Environmental Oualitv , , , Totals -Environmental Protection Aoencv Nuclear Regulatory Commission 1, "' 12, ,754, '"'''''~'275,113.74'~~ 2,5o'9;24<t85' '2;784,358:'59 u.s. Nuclear Regulatory Commission Nuclear Education Grant Program KANSAS STATE 7l.006 UNIVERSITY/ (403.63) (403.63) (403.63) (403.63) U. S. Nuclear Regulatory Commission Nuclear Education Grant Proaram Direct Pronrams: UN IV OF KANSAS/ FY , , , , Nuclear Reaulatorv Commission U.S. Nuclear Regulatory Commission Scholarship and Fellowship Prooram Totals- Nuclear Regulatory Commission U.S. Department of Enerav NRC , , , m2t4, , ww ~232,463,90' 65, , , "'"'''"''232;463:9o' ~-~232~463.9o U.S. Department of Enerav U.S. Department of Enerav U.S. Department of Enerav U.S. Department of EnerQv U.S. Department of Energy U.S. Department of Energy U.S. Department of Energy ARGONNE NATL LAB/ OF BATTELLE/ BATTELLE/ BATTELLE/ BATTELLE PACIFIC NORTHWEST LABORATORY/ CARNEGIE INST OF WASHINGTON/ CARNEGIE INST OF WASHINGTON/ 18, , , , , , , , , , , , , , , , , , , , , ,706.03
212 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass~Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non~State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif::ting No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount U.S. Department of Energy FERMI NATL , , ACCELERATOR LABORATORY/ P U.S. Department of Energy FERMI NATL 32, , , , ACCELERATOR LABORATORY/ PO# , UTA U.S. Department of Energy FERMINATL 39, , , , ACCELERATOR LABORATORY/ P0# U.S. Department of Energy FERMI NATL 41, , , , ACCELERATOR LABORATORY/ U.S. Department of Energy HOUSTON ADVANCED 38, , , , RES CTR/ EFDT/P-T/0 U.S. Department of Energy IDAHO NATL 7, , , , ENGINEERING LAB/ U.S. Department of Energy LAWRENCE BERKELEY 10, , , , NAT L LAB/ U.S. Department of Energy LAWRENCE BERKELEY 20, , , , NAT L LAB/ U.S. Department of Energy LAWRENCE BERKELEY 56, , , , NAT L LAB/ U.S. Department of Energy LAWRENCE BERKELEY 272, , , , NAT L LAB/ U.S. Department of Energy LAWRENCE BERKELEY 5, , , , NAT L LAB/ U.S. Department of Energy LAWRENCE BERKELEY 34, , , , NAT L LAB/ U.S. Department of Energy LAWRENCE LIVERMORE 40, , , , NATL LAB/ U.S. Depa1iment of Energy LAWRENCE LIVERMORE NATL LAB/ U.S. Department of Energy LAWRENCE LIVERMORE 29, , , , NATL LAB/ U.S. Department of Energy LAYLINE PETROLEUM 14, , , , LLC?/ UTA U.S. Department of Enerov LOS ALAMOS NATL LAB/ U.S. Department of Enerov LOS ALAMOS NATL LAB/ , , U.S. Department of Enerqy LOS ALAMOS NATL LAB/ 56, , , , U.S. Department of Enerqy LOS ALAMOS NATL LAB/ 26, , , , U.S. Department of Enerqv LOS ALAMOS NATL LAB/ , , U.S. Department of Energy NATL RENEWABLE 45, , , , w "' ENERGY LAB/ AFT U.S. Department of Energy NATL RENEWABLE 10, , , , ENERGY LAB/
213 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through N 0 Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and.j>. Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount AGV U.S. Department of Energy NATL RENEWABLE 42, , , , ENERGY LAB/ XEJ U.S. Department of Energy NATL RENEWABLE 49, , , , ENERGY LAB/ XGG U.S. Department of Energy NAVIGANT CONSULTING , , , INC./ TSA-11 Task Order No. 3 U.S. Department of Enerav NVIDIA CORP/ , , , U.S. Department of Energy OAK RIDGE ASSOCIATED 4, , , , UNIVERSITIES/ CK DTD 5!8112 U.S. Department of Energy ORGANIC FUELS ALGAE (175.23) (175.23) (175.23) (175.23) TECHNOLOGIES LLC/ UTM8-087 (LOA) U.S. Depa11ment of Energy ORGANIC FUELS ALGAE 21, , , , TECHNOLOGIES LLC/ UTM8-087 AMD No. 018 U.S. Department of Energy ORGANIC FUELS ALGAE 48, , , , TECHNOLOGIES LLC/ UT M8-087 AMD No. 022 U.S. Department of Energy PACIFIC NORTHWEST , , , LABORATORY/ U.S. Department of Energy PACIFIC NORTHWEST 147, , , , LABORATORY I U.S. Department of Energy PACIFIC NORTHWEST 87, , , , LABORATORY/ TASK 4 U.S. Department of Energy PACIFIC NORTHWEST 29, , , , LABORATORY/ 95172MOD 11 U.S. Department of Energy RESEARCH PARTNERSHIP 17, , , , TO SECURE ENERGY/ U.S. Department of Energy U.S. Department of Energy U.S. Department of Energy U.S. Department of Energy U.S. Department of Energy U.S. Department of Energy U.S. Department of Energy RESEARCH PARTNERSHIP TO SECURE ENERGY/ Mod 6 RESEARCH PARTNERSHIP TO SECURE ENERGY/ RESEARCH PARTNERSHIP TO SECURE ENERGY/ RESEARCH PARTNERSHIP TO SECURE ENERGY/ RESEARCH PARTNERSHIP TO SECURE ENERGY/ RESEARCH PARTNERSHIP TO SECURE ENERGY/ RESEARCH PARTNERSHIP TO SECURE ENERGY/ 35, , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,411.61
214 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount U.S. Department of Energy U.S. Department of Energy ; LOA: P. /CHHUBUJ.GALE RESEARCH PARTNERSHIP TO SECURE ENERGY/ RESEARCH PARTNERSHIP TO SECURE ENERGY/ 35, , , , , , , , , U.S. Department of Enerav RICE UNIV/ , R/6873 U.S. Department of Enerov SANDIA NATL LABS/ , , , PO U.S. Department of Enerov SANDIA NATL LABS/ 24, , , (REF MASTER AGRMT ) U.S. Department of Enerav SANDIA NATL LABS/ 40, , , , U.S. Department of Enerov SANDIA NATL LABS/ , , U.S. Department of Enerov SANDIA NATL LABS/ 207, , , , U.S. Department of Enerov SANDIA NATL LABS/ 1, , , , U.S. Department of EnerQV SANDIA NATL LABS/ 2, , , , U.S. Department of Enerav SANDIA NATL LABS/ 65, , , , U.S. Department of Enerov SANDIA NATL LABS/ 74, , , , U.S. Department of Enerov SANDIA NATL LABS/ , , , U.S. Department of Enerov SANDIA NATL LABS/ 32, , , , U.S. Department of Enerov SANDIA NATL LABS/ 61, , , , U.S. Department of Enerav SANDIA NATL LABS/ , , U.S. Department of Enerav SANDIA NATL LABS/ , , , U.S. Department of Enerov SANDIA NATL LABS/ 14, , , , U.S. Department of Enerov SANDIA NATL LABS/ , , , U.S. Department of Enerav SANDIA NATL LABS/ 15, , , , U.S. Department of Enerav SANDIA NATL LABS/ 10, , , , U.S. Department of Energy UNIV OF WISCONSIN- 28, , , , MADISON/ 353K312 U.S. Department of Enerav URS/ 48, , , , RES/ U.S. Department of Enerav URS/ 42, , , US/ U.S. Department of Enerav UT -BATTELLE LLC/ 5, , , , LOA - PRUDENC/0 U.S. Department of Enerov UT -BATTELLE LLCI 90, , , , U.S. Department of Enerov ZYVEXI 52, , , UTAOB-601 ARRA- U.S. Department of Energy DENBURY RESOURCES/ 142, , , , "" 0 0'1 AP&C /NC;DE-F & DE-FE ARRA- U.S. Department of Enerov DENBURY RESOURCES/ 142, , ,
215 Schedule 1A Cont. 1\) Pass-Through Pass-Through Pass-Through 0 Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Ol Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Arnoynt Arnou_nt Amount Amount LEUCADIA; DE-FE & DE-FE ARRA- U.S. Department of Energy NATL RENEWABLE 45, , , , ENERGY LAB/ XGG ARRA- U.S. Deoartment of Enerov NRG ENERGY INC./ , UTA ; PO# ;LINE ITEM #1&2 ARRA- U.S. Department of Energy PECAN STREET PROJECT 108, , , , INC./ UTA ARRA- U.S. Department of Enerov SANDIA NATL LABS/ , , , ARRA- U.S. Department of Enerov SANDIA NATL LABS/ 99, , , , ARRA FUNDS ARRA- U.S. Deoartment of Enerov SIEMENS/ , UTA Office of Science Financial Assistance 12, , , , ANASYS INSTRUMENTS/ Proaram UTA Office of Science Financial Assistance 3, , , , DUKE UNIV/ Prooram 08-SC-N/CCR-1071 Office of Science Financial Assistance DUKE UNIV/ Prooram 09-N/CCR-1076 Office of Science Financial Assistance INTELLIGENT OPTICAL 9, , , , Proaram SYSTEMS INC/ 3215-UTA Office of Science Financial Assistance ROTATING SLEEVE 19, , , , Program ENGINE TECHNOLOGIES INC/ UTA Office of Science Financial Assistance 10, , , SILICON AUDIO LABS INC/ Proaram UTA Office of Science Financial Assistance 2, , , , SILICON AUDIO LABS INC/ Prooram UTA Office of Science Financial Assistance TULANE UNIV/ Proaram TUL Office of Science Financial Assistance UNIV OF DELAWARE/ Pro a ram Office of Science Financial Assistance 19, , , , XIA LLC/ Proaram UTA ARRA- Office of Science Financial 33, , , , COLUMBIA UNIV/ Assistance Prooram 3 (ACCT# ) ARRA- Conservation Research and 39, , , , GENERAL MOTORS/ Develooment GVS00492 Renewable Energy Research and 53, , , , ARIZONA STATE UNIV/ Develooment Renewable Energy Research and 56, , , , ASTROWATT/ Oevelooment UTA Renewable Energy Research and STANFORD UNIV/ 40, , , , Develooment M ARRA- Renewable Energy Research ARIZONA GEOLOGICAL 201, , , , and Develooment SURVEY/
216 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agyl To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non..State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount TX-EE PO# BGS11TX98 ARRA- Renewable Energy Research and SOUTHERN METHODIST , , , Development UNIVERSITY/ G00/ Fossil Energy Research and 833, , , , , Development Stewardship Science Grant Program ~~~;~~RB~;;~~ES SSEB-SECARB T138EG- T/ STANFORD UNIV/ 25, , , , A Stewardship Science Grant Prooram UNIV OF MICHIGAN/ (0.02) (0.02) (0.02) (0.02) Nuclear Energy Research, Development MEDICAL UNIV OF S 9, , , , and Demonstration CAROLINA/ MUSC/2-007 ARRA - Electricity Delivery and Energy 143, , , , _122 ~N~C;N STREET PROJECT Reliability, Research, Development and An;:llvsis ARRA- Electricity Delivery and Energy Reliability, Research, Development and Analvsis ARRA -Electricity Delivery and Energy Reliability, Research, Development and Analvsis ARRA- Electricity Delivery and Energy Reliability, Research, Development and Analvsis Predictive Science Academic Alliance Proaram ARRA- Geologic Sequestration Training and Research Grant Program ARRA -Industrial Carbon Capture and Storaae lccs) Aoolication Advanced Research and Projects Agency- Energy Financial Assistance Pronmm Advanced Research and Projects Agency- Energy Financial Assistance Program Advanced Research and Projects Agency- Energy Financial Assistance Program DE-FOA ; PRIME PECAN STREET PROJECT INC./ DE-FOA ; UTA PECAN STREET PROJECT INC./ DE-FOA ; UTA PECAN STREET PROJECT INC./ DE-FOA : UTA PURDUE UNIVI /0AMD ~~~;~~RB~;;~~ES SSEB-SECARB_ED-920- TXBEG SIEMENS/ UTA I PO _135 ~~~~~~~USETTS INST SHARP LABORATORIES OF AMERICA/ UTA UN IV OF NEVADA- LAS VEGAS/ 137, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , A-00 ARRA- Advanced Research and UNITED TECHNOLOGIES 124, , , , Projects Agency- Energy Financial RESEARCH CTRI IV Assistrm~P. Pronr<'lm j Direct Proc;::rrams: U.S. Department of Enerqv DE-AC52-09NA , , , , ,388.96
217 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non..State Entities Expenditures Grantor/Proaram Title No. NSE Name/ldentifyina No. No. Amount Amount Amount Amount No. Amoum Amount Amount Total PTTo and Expenditures Amount N 0 00 U.S. Department of Energy ~':;;;G02-03ER15406 U.S. Department of Enersw DE-SC U.S. Department of Energy LDA-BENO I S F U.S. Department of Energy S F U.S. Department of Energy U.S. Department of Enerav Office of Science Financial Assistance Proaram ARRA -Office of Science Financial Assistance Prooram Office of Science Financial Assistance Pro a ram Pass- Throu.Qh To: University of Texas at Dallas , , , , , (2,388.32) (2,388.32) 58, ,081, ,081, ,447, ,447, , , , , , , , (2,388.32) 58, ,789, ,447, , , , (2,388.32) ,081, ,447, , Renewable Energy Research and Develooment ARRA ~Renewable Energy Research and Develooment Fossil Energy Research and Development Fossil Energy Research and Development Pass- Throu.qh To: University of Texas at San Antonio , , , , ,234, ,234, , , , , , , , ,938, , , ,234, , Stewardship Science Grant Prooram Defense Nuclear Nonproliferation Research Nuclear Energy Research, Development and Demonstration Predictive Science Academic Alliance Proaram Predictive Science Academic Alliance Proaram Pass- Through To: Texas A&M Engineering Experiment Station 2,211, , , , , ,970, ,970, , , , , , ,204, , , ,918, , , ,970, , ARRA- Geologic Sequestration Site Characterization ARRA- Geologic Sequestration Training and Research Grant Proaram ARRA -Industrial Carbon Capture and Storace (CCS) Application Advanced Research and Projects Agency- Energy Financial Assistance Program , , , , ,199, ,199, ,935, ,935, , , , , , , ,443, , , ,199, ,935, Pass-Through From: ARRA- State Enerov Prooram Pass-Throu.Qh From: Comptroller- State Energy 907 Conservation Office (6,840.37) (6,840.37) (6,840.37) ( ) Fossil Energy Research and Development , , , Pass-Through From: University of Houston , State Enerov Prooram Special Projects Pass-Through From: Comptroller- State Energy 907 Conservation Office 127, , , State Enerov Prooram Special Projects Pass-Throu.qh From: 84, ,693.43
218 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non~State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/tdentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Comptroller- State Energy , Conservation Office Pass- Throu.oh To: Universdv of Texas at Arlin.oton Totals- U.S. Department of Energy 231, ,883, ,552, ,667, , ,224, ,284, ,667, U.S. Department of Education U.S. Department of Education U.S. Department of Education 84_000 ~f~~~~t~uth SCHOOL UTA UNIVERSITY OF OREGON/ , , , , ARRA- U.S. Department of Education FLORIDA DEPT OF , , , EDUCATION/ Comorehensive Centers RMC RSCH CORP/ 29, , UTA YEAR 7 Education Research, Development and 41, , , , NEW YORK UNIVERSITY/ Dissemination F Education Research, Development and UN IV OF LEUVEN 120, , , j), Dissemination (BELGIUM)/ UTA ; RD035D Education Research, Development and 54, , , , UN IV OF NEBRASKA/ Dissemination Research in Special Education UN IV OF NORTH , , CAROLINA AT CHAPEL HILL/ Special Education- Personnel 33, , , , Development to Improve Services and UNIV OF FLORIDA/ Results for Children with Disabilities UF/ Special Education_ Technical 433, , , , Assistance and Dissemination to Improve Services and Results for ~~~~~i~~e~iv r.hilrlro:>n 1 tith llioc:~hilitio:>c:: F UTA Improving Teacher Quality State Grants 84 _367 ~~~~~RITING PROJECT 2, , , , TX11-SEED2012 (AMEND. NO 1) Improving Teacher Quality State Grants NATL WRITING PROJECT 19, , , , CORP/ 02-TX11-SEED2012 (ORIGINAL) Direct ProQrams: International Research and Studies Fund for the Improvement of 153, , , , Postsecondary Education Assistive Technoloav , , , Education Research, Development and 3,678, ,678, , ,005, ,678, Dissemination Education Research, Development and 534, , , Dissemination Pass-Throu.oh To: Texas A&M University , N Education Research, Development and 597, , , Dissemination Pass- Throu..qh To: Univers11y of Houston , co
219 Schedule 1A Cont. Pass-Through Agy!U From Agencies or Federal Grantor/Pass-through CFDA niv Universities Grantor/ProQram Title No. NSE Name/ldentifvinQ No. No. Amount Pass-Through From Non State Entities Amount Direct Program Amount Pass-Through Total PT From and Agy/ To Agencies or Direct Prog. Univ Universities Amount No. Amount Pass-Through To Non-State Entities Amount Expenditures Amount Total PT To and Expenditures AmoUnt ~ 0 Education Research, Development and Dissemination Pass~ Throu.qh To: University of Texas at Dallas (16,128.51) (16,128.51) 738 (16,128.51) (16,128.51) Education Research, Development and Dissemination Pass~Throu..qh To: Univers!ly of Texas Health Science Center at Houston , , , , Research in Special Education Special Education- Personnel Development to Improve Services and Results for Children with Oi.sahilities Special Education_Technical Assistance and Dissemination to Improve Services and Results for Children with Disabilities International Education_ T echnologicaf Innovation and Cooperation for Foreign Information Access Pass-ThrouQh From: 831, , , , , , , , , , , , , Education Research, Development and Dissemination Pass-Throu_qh From: University of Houston , , , , Strivina Readers Pass-Through From: Texas Education Aoencv , , , , Colleoe Access Challenae Grant Proqram Pass-Through From: Texas Higher Education Coordinating Board , , , Totals- U.S. Department of Education 536, ,078, ,153, ,768, ,479, , ,329, , 768, United States Institute of Peace Direct Programs: United States Institute of Peace Totals- United States Institute of Peace U.S. Department of Health and Human Services US/P F 89, , , ,398.24?.~-~-~ , ,~ , U.S. Department of Health and Human Services U.S. Department of Health and Human Services U.S. Department of Health and Human Services U.S. Department of Health and Human Services U.S. Department of Health and Human Services U.S. Department of Health and Human Services ASSOC OF SCHOOLS OF PUBLIC HEALTH/ J5021 BAYLOR COLLEGE OF MEDICINE/ DIETARY BAYLOR COLLEGE OF MEDICINE/ PBS BAYLOR COLLEGE OF MEDICINE/ ULNAR BAYLOR COLLEGE OF MEDICINE/ COMMUNITY ACTION INC/ UTA , , , , , , , , , , , , , , , , , , , , , , , , ,344.24
220 Schedule 1A Cont. Pass~ Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentifling No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount U.S. Department of Health and Human CORNELL UNIV/ Services U.S. Department of Health and Human HOUSTON ACADMEY OF 7, , , , Services MEDICINE/ UTA U.S. Department of Health and Human 71, , , , OMEGA OPTICS/ Services UTA U.S. Department of Health and Human PROFESSIONAL & 10, , , , Services SCIENTIFIC ASSOC. INC./ PSA Checks U.S. Department of Health and Human 1, , , , SCRIPPS RSCH INST/ Services U.S. Department of Health and Human 80, , , , SCRIPPS RSCH INST/ Services U.S. Department of Health and Human 111, , , , UN IV OF GEORGIA/ Services RU ! U.S. Depa11ment of Health and Human UNIV OF NORTH 21, , , , Services CAROLINA AT CHAPEL HILL/ UTA Cooperative Agreements to Improve the 7, , , , Health Status of Minority Populations 93 _004 ~~~~~;SPANIC MEDICAL NHMA-OMH-6-10 Laboratory Leadership, Workforce 93, , , , , Training and Management Development, Improving Public Health ~~;~~H0 :A~~~~~ORIES/ I :::.hnr:::.tnr\1 lnfr::~c:tnll"fiii'p Environmental Health ~:sei~~sei~~~ptical 56, , , ,386.31!05#3217--UTA Environmental Health UN IV OF NORTH 3, , , , CAROLINA AT CHAPEL HILL/ Human Genome Research SERALOGIX INC/ UT-SLX Research Related to Deafness and SILICON AUDIO LABS INC/ 29, , , , Communication Disorders UTA Policy Research and Evaluation Grants STANFORD UNIV/ 16, , , , Mental Health Research Grants G ~~~~~~~ESEARCH 80, , , , R01 MH Mental Health Research Grants OREGON RESEARCH 38, , , , INSTITUTE/ R01MH Mental Health Research Grants UNIV OF WASHINGTON/ 1, , , , Mental Health Research Grants YALE UNIV/ , M13A (A08021) Substance Abuse and Mental Health 2, , , , Services_Projects of Regional and 93 _243 ~~~~~~~; TH & HUMAN National Significance Substance Abuse and Mental Health Services_Projects of Regional and National Sionificance BCFS HEALTH & HUMAN SERVICES/ 22603AMD3 42, , , , N ~...
221 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through ~ Agy/U From Agencies or From Non~ Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and N Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Namendentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Substance Abuse and Mental Health 3, , , , Services_Projects of Regional and MERCER UNIV/ National Sianificance UT-03 Infant Adoption Awareness Training ~~~~gon EXCHANGE 60, , , , UTAII Infant Adoption Awareness Training ADOPTION EXCHANGE 319, , , , ASSOCi UTA Alcohol Research Programs ~~~o:r,~l RESEARCH 36, , , , Alcohol Research Programs SAN DIEGO STATE UNIV 137, , , , RSCH PDN/ 53253J P/ Alcohol Research Programs SAN DIEGO STATE UNIV 1, , , , RSCH FDN/ 53253J P {CARRYFWD) The Affordable Care Act: Centers for ( ) (1,689.16) (1,689.16) (1,689.16) Disease Control and Prevention_lnvestigations and ~~!~T~7PT OF PUBLIC T_.,.hnil'::~l Ac::c::ic::t~nt'P UTA The Affordable Care Act: Centers for 10, , , , Disease Control and STANFORD UNIV/ Prevention_lnvestigations and Technical A~~l~t;:mf":P A AMD 1 The Affordable Care Act: Centers for 4, , , , Disease Control and STANFORD UNIV/ Prevention_lnvestigations and Technical A$::~l~t;mf":P A AMD 2 Discovery and Applied Research for 125, , , , Technological Innovations to Improve BOSTON UNIV/ Hum::~;n HP.;:~Ith Minority Health and Health Disparities 1, , , , ~~~V~~~~y;TATE Research P AMD 4 Trans-NIH Research Support CORNELL UNIV/ 104, , , , ; PO# Research Infrastructure Programs ~~~~F~F SOUTHERN 7, , , , Cancer Cause and Prevention Research g~; ~:c~~~~ ~~~LH~iD 11, , , , Z6697;PO NO Cancer Cause and Prevention Research NORTHSHORE UNIV 67, , , , HEAL THSYSTEM/ EH/2-358-SI Cancer Cause and Preventidn Research NORTHSHORE UNIV (69,410.42) (69,410.42) (69,410.42) (69,410.42) HEAL THSYSTEM/ ; PO# Cancer Cause and Prevention Research UNIV OF MINNESOTA/ , , P Cancer Detection and Diagnosis 173, , , , RICE UNIV/ Research R22083
222 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount PPHF 2012: Community Transformation 29, , , , Grants and National Qissemination and Support for Community Transformation AUSTIN CITY OF/ Grants Health Care Innovation Awards (HCIA) Social Services Research and Demonstration Adoption Opportunities Trans-NIH Recovery Act Research Suooort ARRA- Trans-NIH Recovery Act Research Suooort ARRA- Trans-NIH Recovery Act Research Suooort Cardiovascular Diseases Research UTA-HPWP ~~~~~~SH~~~JH CARE UTA ~~~~~~~~~ERN SP PROJ , , , , , , , , ~~~~~~ON EXCHANGE 37, , , , UTA/ RICE UNIV/ R22041 COLUMBIA UN IV/ 2( ) UN IV OF FLORIDA/ UF/ CLEMSON UNIVERSITY/ 125, , , , , , , , , , , , , , , , , Cardiovascular Diseases Research UN IV OF PITISBURGH/ 280, , , , ( ) Diabetes, Digestive, and Kidney ~~g~~~:6n~0 OF Diseases Extramural Research RA982-G1 Diabetes, Digestive, and Kidney Diseases UNIV OF SOUTHERN 19, , , , Extramural Research CALIF/ (H51496) UTA Extramural Research Programs in the 23, , , , Neurosciences and Neurological ~!'~6CL~~~NIV OF S f)i.sordp.r.s MUSC/2-045 Extramural Research Programs in the 23, , NORTHWESTERN 23, , Neurosciences and Neurological Disorders UNIVERSITY/ Extramural Research Programs in the Neurosciences and Neurological Disorders Extramural Research Programs in the Neurosciences and Neurological Disorders Extramural Research Programs in the Neurosciences and Neurological Disorders Allergy, Immunology and Transolantation Research Allergy, Immunology and Transplantation Research Allergy, Immunology and Transplantation Research Allergy, Immunology and Transplantation Research J005 U TEXAS AUSTINOO SEATTLE CHILDREN S RSCH INST/ 10595SUB SEATTLE CHILDREN S RSCH INST/ 10689SUB UNIV OF BRITISH COLUMBIA/ F ~~~~~;/RES INST AT GUILD ASSOCIATES INC./ UTA HEALTH RESEARCH INC./ 47, , , , , , , , (7,910.34) (7,910.34) (7,910.34) (7,910.34) 169, , , , , , , , Ul ,85 LUMINEX CORP/ ::i
223 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non~ Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Prooram Title No. NSE Namelldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount N ~ Allergy, Immunology and Transplantation Research Allergy, Immunology and Transplantation Research Allergy, Immunology and Transplantation Research R01AI UTA YR1 UTA LUMINEX CORP/ UTA LUMINEX CORP/ 5RO 1AI YR2 UTA LUMINEX CORP/ 5R01A/ YR3 UTA , , , , , , , , , Biomedical Research and Research 71, , , CORNELL UNIV/ 71, Trainina Biomedical Research and Research MONTEREY BAY 63, , , , Train ina AQUARIUM RESCH INST/ P0# Biomedical Research and Research Trainina Biomedical Research and Research Train ina Biomedical Research and Research Trainina PRINCETON UNIV/ 1985 STANFORD UNIV/ C 2P01GM WASHINGTON UNIV/ WU ; PO W 160, , , , , , , , , , , , Biomedical Research and Research 130, , , , YALE UNIV/ Trainina M09A (A08323) Child Health and Human Development , , , Extramural Research ~~~~~T~SR~~~~~~~~ S Child Health and Human Development BAYLOR COLLEGE OF 30, , , Extramural Research MEDICINE/ ; Child Health and Human Development GEISINGER MEDICAL 10, , , , Extramural Research CENTER/ 7R03HD068691; UTA Child Health and Human Development OREGON RESEARCH 165, , , , Extramural Research INSTITUTE/ R01HD Child Health and Human Development UN IV OF LOUISVILLE RES 30, , , , Extramural Research FDTN/ OGM TX AUSTIN Child Health and Human Development WEILL CORNELL MEDICAL Extramural Research COLLEGE/ Child Health and Human Development WEILL CORNELL MEDICAL 253, , , , Extramural Research COLLEGE/ PO# Aging Research 93 _866 ~~~~~~N~~AI SCHOOL OF 51, , , , AMD. 2 SUPP. Aging Research MOUNT SINAl SCHOOL OF 300, , ,018,77 300, MEDICINE/ AMEND N0.2 Vision Research OHIO STATE UNIV/ 40, , , , UT Medical Librarv Assistance UNIV OF WISCONSIN/ 77, , , , K204
224 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non..State Entities Expenditures Expenditures Grantor/Prooram Title No. NSE Namelldentifyina No. No_, Amount AffiQJJnt Amount Amount No. Amount Amount Amount Amount HIV Demonstration, Research, Public and Professional Education Projects g~~o~~n~oc~:hrlotte/ 5, , , , Direct Programs: UTX AMD No. 1 U.S. Department of Health and Human Services U.S. Department of Health and Human Services U.S. Department of Health and Human Services Environmental Health Oral Diseases and Disorders Research Oral Diseases and Disorders Research Pass- Throu_qh To: Texas Tech University Health Sciences Center HHSF P ROt NS IA REVISED 5 R24 HD , , ,510, , , , , , , , , ,510, , , , , , , , , NIEHS Superfund Hazardous Substances_Basic Research and Education Human Genome Research Research Related to Deafness and Communication Disorders Research on Healthcare Costs, Quality and Outcomes Mental Health Research Grants Substance Abuse and Mental Health Services_Projects of Regional and National Sianificance Alcohol Research Proorams Drug Abuse and Addiction Research Proorams Drug Abuse and Addiction Research Proarams Pass-Throu_qh To: University of Texas Medical Branch at Galveston ,708, , ,680, , ,287, ,970, , , , ,708, , ,654, '708, , , , , , ,541, ,680, , , , , ,287, , ,227, , ,970, , ,795, ,970, , , The Affordable Care Act: Centers for Disease Control and Prevention_lnvestigations and Technical Assist::mr.P. The Affordable Care Act: Centers for Disease Control and Prevention_lnvestigations and Technical Assisf;:tnr.P. Pass- Throu_qh To: University of Houston , , , , , , , , , Discovery and Applied Research for Technological Innovations to Improve Human Health Discovery and Applied Research for Technological Innovations to Improve Human Health Pass-Throu_qh To: University of Texas MD. Anderson Cancer Genter Minority Health and Health Disparities Research Trans-NIH Research Support Nursino Research National Center for Research Resources Cancer Cause and Prevention Research Cancer Cause and Prevention Research ,016, , , , , , ,497, , ,016, , ,866, ,016, , , , , , , , ,353, , , , ,342, ,418, , , , , , ,322, ,497, , ~ (J1
225 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through ~ Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and C1l Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Namendentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Pass- Throu_qh To: University of Texas Health Science , Center at San Antonio Cancer Detection and Diagnosis Research Cancer Detection and Diagnosis Research Pass-Through To: UniversJly of Texas M.D. Anderson , Cancer Center 870, , , , , , , , Cancer Treatment Research ,750, , , ,420, Cancer Treatment Research , , , Pass- Throu.Qh To: University of Texas MD. Anderson , Cancer Center Cancer Treatment Research , , , Pass- Throu_qh To: Univers1ly of Houston , Cancer Bioloov Research , , , Cancer Research Manpower , , , University Centers for Excellence in (30.69) (30.69) (30.69) (30.69) Developmental Disabilities Education, Research. and Service Trans-NIH Recovery Act Research 510, , , , Suooort ARRA- Trans-NIH Recovery Act Research 93 _ , , , , Suooort Cardiovascular Diseases Research ,893, ,893, ,234, , ,893, Diabetes, Digestive, and Kidney Diseases 544, , , Extramural Research Extramural Research Programs in the 3,110, ,110, , ,973, ,11 0, Neurosciences and Neurological Disorders Allergy, Immunology and Transplantation 3,520, ,520, , ,274, ,520, Research Allergy, Immunology and Transplantation 10, , , Research Pass- Through To: University of Texas Medical Branch at , Galveston Microbiology and Infectious Diseases 306, , , , Research Biomedical Research and Research 9,055, ,055, , ,774, ,055, Trainina Child Health and Human Development 3,648, ,648, , ,911, ,648, Extramural Research Aoino Research ,226, , , , , Vision Research ,307, , , ,299, ,307, Pass-Throuoh From: U.S. Department of Health and Human Services Pass-Throunh From: University of Texas Health Science 745 9, Center at San Antonio U.S. Department of Health and Human Services Pass- Through From: University of Texas Health Science , Center at San Antonio U.S. Department of Health and Human Services , , , , , ,
226 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non~State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Pass~ Through From: University of Texas Health Science Center at San Antonio U.S. Department of Health and Human Services / Pass-Through From: University of Texas Health Science 745 3, Center at San Antonio 3, , , U.S. Department of Health and Human 9, , , Services Pass- Throu.qh To: University oft ex as Health Science BAYLOR COLLEGE OF 745 9, Center at San Antonio MEDICINE/ ULNAR Cooperative Agreements to Improve the 4, , , Health Status of Minoritv Pooulations Pass- Throu.qh To: University of Texas at Arlington NATL HISPANIC MEDICAL 714 4, AS SOC/ NHMA-OMH-6-10 Public Health Emerqencv Preoaredness , , , Pass-Through From: Department of State Health Services , Environmental Health , , Pass~ Through From: University of Texas MD. Anderson , Cancer Center Environmental Health , ' , Pass-Through From: Texas A&M University System Health , Science Center Research on Healthcare Costs, Quality and Outcomes Pass-Through From: University of Texas Health Science , Center at Houston 47, , , Substance Abuse and Mental Health 25, , , Services_Projects of Regional and National Sianificance Pass-Throu.oh From: Department of State Health Services , Universal Newborn Hearina Screenina , , , Pass-Through From: Department of State Health Services , Occuoational Safetv and Health Proaram , , , Pass-Throu.Qh From: University of Texas Health Science , Center at Houston The Affordable Care Act: Centers for 44, , , Disease Control and Prevention_lnvestigations and Technical A,:;,:;;.i.;:f;o\nr.P. Pass- Throuah From: Department of State Health Services , N -..!
227 Schedule 1A Cant Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures N Grantor!Prog:ram Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount 00 The Affordable Care Act: Centers for 6, , , Disease Control and Preventionjnvestigations and Technical As.~ist::~nr:P. Pass-Throu_qh From: University of Texas at Tyler 750 6, Cancer Detection and Diagnosis Research Pass- Throu.Qh From: University of Texas MD. Anderson , Cancer Center Cancer Detection and Diagnosis Research Pass- Throu.ah From: University of Texas Health Science ,067,02 Center at Houston 222, , , , , , Cancer Centers Suooort Grants , , Pass- Throu.ah From: University of Texas MD. Anderson , Cancer Center PPHF 2012: Community Transformation 12, , , Grants and National Dissemination and Support for Community Transformation Gr::~nts Pass-Throu.ah From: Texas A&M AgriUfe Extension , Service Developmental Disabilities Basic Support and Advocacv Grants Pass- Throu_qh From: Texas Education A.aencv , , , ARRA- Trans-NIH Recovery Act Research , , , Suooort Pass-Through From: Texas Tech University Health , Sciences Center ARRA- Health Information Technology Professionals in Health Care Pass-Through From: Texas State University M San Marcos , , , , Cardiovascular Diseases Research , , , Pass- Through From: University of Texas at San Antonio , Extramural Research Programs in the 13, , , Neurosciences and Neurological Disorders Pass- Throu_qh From: University of Texas Health Science , Center at San Antonio Allergy, Immunology and Transplantation Research Pass-Throu.Qh From: University of Texas Medical Branch at , Galveston Allergy, Immunology and Transplantation Research , , , , , ,929.51
228 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/ldentif~ing No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Pass-Through From: University of Texas Southwestern , Medical Center at Dallas Child Health and Human Development Extramural Research Pass-Through From: University of Houston , , , , Aoino Research , , , Pass-Through From: University of Texas Medical Branch at 723 6, Galveston Vision Research , , , Pass-Through From: University of Houston HIV Prevention Activities_Health Deoartment Based Pass-Through From: Department of State Health Services , , , , Block Grants for Community Mental Health Services Pass-Through From: Department of State Health Services , , , , Block Grants for Prevention and Treatment 93 _ , , , of Substance Abuse Pass-Through From: Department of State Health Services , Cooperative Agreements for State-Based 25, , , , Diabetes Control Programs and Evaluation of Surveillance Svstems Pass-Through From: Department of State Health Services , Totals -U.S. Department of Health and 4,374, ,522, ,426, """'' 64,323,827:54 656,755.74'.. 4,690,472:!i(f 58,976, ,323, Human Services Corporation for National and Community Service AmeriCorps AmeriCorps AmeriCorps ONE STAR FOUNDATION/ UTA ONE STAR FOUNDATION/ 11AC ONE STAR FOUNDATION/ (581.79) (581.79) (581.79) (581.79) (8,050.19) (8,050.19) (8,050.19) (8,050.19) 1,433, ,433, ,433, ,433, AC Totals- Corporation for National and 1,424,708.si 1,424,768:51 1 :42<(7ilil:"5'i.. 'i,4:247'768':51 Community Service U.S. Department of Homeland Security ~ Assistance to Firefighters Grant ~~~/PROTECTION RSCH 210, , , , <0 National Nuclear Forensics Expertise Develooment Proaram UTA ~!~~L~~~NIV OF S MUSC/ , , , ,852.00
229 Schedule 1A Cont. Federal Grantor/Pass-through CFDA Grantor/Prooram Title No. NSE Namelldentifving No. Pass-Through Agy/U From Agencies or niv Universities No. Amount Pass-Through From Non- State Entities Amount Direct Program Amount Pass-Through Total PT From and Agy/ To Agencies or Pass-Through To Total PTTo and 0 Direct Prog. Univ Universities Non-state Entities Expenditures Expenditures Amount No. Amount Amount Amount Amount "' National Nuclear Forensics Expertise Develooment Prooram Direct Pro11rams: MEDICAL UN IV OF S CAROLINA/ MUSC/ , , Homeland Security Advanced Research Proiects Aaencv Homeland Security Research Testing, Evaluation, and Demonstration of Technologies Related to Nuclear Detection , , , , , , , , Homeland Security, Research, Testing, Evaluation, and Demonstration of Technolooies Totals- U.S. Department of Homeland Security U. S. Agency for International Development , , , , , '57, "'foo:sfi37.. ""'"""756:'855:44 "~~-'857~368:81 USAID Foreign Assistance for Proarams Overseas USAID Foreign Assistance for Programs Overseas Pass-Throu!lh From: ~~~~~GE OF WILLIAM & C ENGILITY CORP.I UTA OOIMODN , , , , , , , USAID Foreign Assistance for Programs Overseas Pass-Through From: University of Texas at San Antonio , , , Totals-U.S. Agency for International Development Education of Homeless Children and Youth Cluster "4, , 159.ii6'" '4613:' ;'352:66 "' 4oa.3o2~6- U.S. Department of Education Education for Homeless Children and Youth Education for Homeless Children and Youth Totals- U.S. Department of Education ~~g(;~~n SERVICE CTR- UTA EDUCATION SERVICE CTR- REGION X/ UTA , , : , , , , , , ,@ 674,577.73' '"''"'"'"~674:577~73""'' '"" ''"674:577:73. Highway Planning and Construction Cluster U.S. Department of Transportation Highway Planning and Construction ~~~U~~SSOURI- 28, , , , Highway Planning and Construction C WYOMING DEPT OF TRANSPORTATION/ 32, , , , UTA ; RS06210 Highway Planning and Construction Pass-Throu!lh From: WYOMING DEPT OF TRANSPORTATION/ WYDOTIUTA Contract 23, , , , Hi!lhwav Plannino and Construction Pass-Through From: , ,727.31
230 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Pro g. Univ Universities Non-State Entities Expenditures Expenditures Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Texas Department of Transportation , Totals- U.S. Department of 81, , , , , Transportation Head Start Cluster U.S. Department of Health and Human Services Pass-Throuoh From: ARRA -Head Start , , Pass- Through From: University of Texas Health Science , Center at Houston Totals -U.S. Department of Health and 120, , o.:l:is.:l7 120, Human Services Child Nutrition Cluster U.S. Department of AQriculture Pass-Throuqh From: School Breakfast Proaram , , , Pass-Throu.qh From: Texas Education Aoencv , National School Lunch Proaram (Non-monetary) Pass- Throu.oh From: DeDartment of Aon"culture National School Lunch Prooram , Pass-Throuqh From: Texas Education A.aencv Totals- U.S. Department of Agriculture 114, , , , Special Education (IDEA) Cluster U.S. Department of Education Pass-Throuqh From: Special Education Grants to States ,104, ,104, Pass-Through From: Texas Education A.aencv 701 1,104, Special Education Grants to States , , , Pass-Throu{lh From: University of Houston Totals- U.S. Department of Education 1,284, ,284, ,284, ,284, Economic Development Cluster U.S. Department of Commerce Direct Proorams: Economic Adjustment Assistance , , ~4,Q91,64. 54, Totals- U.S. Department of Commerce 54, , , , N N ~ Student Financial Assistance Cluster U.S. Department of Education
231 Schedule 1A Cont. Pass-Through Pass-Through Pass-Through Agy/U From Agencies or From Non- Total PT From and Agy/ To Agencies or Pass-Through To Total PT To and Federal Grantor/Pass-through CFDA niv Universities State Entities Direct Program Direct Prog. Univ Universities Non-State Entities Expenditures Expenditures ""' N Grantor/Program Title No. NSE Name/Identifying No. No. Amount Amount Amount Amount No. Amount Amount Amount Amount Direct Proqrams: Federal Supplemental Educational ,366, ,366, ,366, ,366, Oooortunitv Grants Federal Work-Studv Proqram ,736, ,736, ,736, , Federal Perkins Loan Program_Federal , ,988, ,988, Caoital Contributions 7,988, Federal Pell Grant Prooram ,856, ,856, ,856, ,856, Federal Direct Student Loans , , ,667,635.00? 6,66~,6}~.QO Totals- U.S. Department of Education 346,615, ,615, ,615, ,615, U.S. Department of Health and Human Services Nurse Faculty Loan Program (NFLP) , , ~,QOQ,Q9.. 1n,qog.qo Totals- U.S. Department of Health and 119, , , Human Services TANF Cluster U.S. Department of Health and Human Services Pass-Throuqh From: Temporary Assistance for Needy Families , Pass-Through From: Texas Workforce Commission , Totals- U.S. Department of Health and , , , Human Services Title I, Part A Cluster U.S. Department of Education Pass-Throuoh From: Title I Grants to Local Educational Aaencies Pass-Through From: Texas Education A_aencv ,175, ,175, ,175, Totals- U.S. Department of Education 1 '175, ,175, ,175, ul5,241.oll TRIO Cluster U.S. Department of Education Direct Proorams: TRIO Student Support Services , , , TRIO_McNair Post-Baccalaureate 215, , , , Achievement Totals- U.S. Department of Education 443, , , Total Expenditures of Federal Awards 26,799, ,031, ,688, ,518, ,692, ,932, , ,518,607.60
232 223 SCHEDULE 1A FOOTNOTES Federal Assistance Schedule -Reconciliation USAS Amount Note 1: Non-Monetarv Assistance No non-monetary assistance received during FY. Note 2: Reconciliation Federal Revenues -per Exhibit 8: Proprietary Funds Federal Revenue Operating Federal Sponsored Program Revenue Non-Operating Federal Nonexchange Sponsored Programs Total Federal Revenues- per Exhibit B/USAS Federal Pass-Through Revenue Operating Federal Sponsored Program Pass-Through Revenue Non-Operating Federal Nonexchange Sponsored Program Pass-Through Revenue Total Federal Pass-Through Revenues- per Exhibit B/USAS 388,674, ,856, ,531, ,445, ,445, ,674, , ,531, ,798, ,798, Total Federal Revenue and Federal Pass-Through Revenue Reconciling Items: ADD: Non-Monetary Assistance: Donation of Federal Surplus Property Total Non-Monetary Assistance New Loans Processed: Federal Family Education Loan Program (FFELP) Federal Perkins Loan Program (Perkins) Federal Direct Student Loans (Direct Loans) Health Education Assistance Loan Program (HEAL) Nursing Faculty Loan Program (NFLP) Health Professions Student Loan Program Nursing Student Loans Program Total New Loans Processed State Unemployment Funds- State Portion Other DEDUCT: CFDA Federal Revenue Received on the Fixed-Fee Basis Contract: Texas A&M Research Foundation (pass through from): Texas A&M Research Foundation (pass through to): Construction Grants: Medicare Part D: Other: ARRA-Cobra Total Other Reconciling Items Total Reconciling Items Total per Note 2: Total Expenditures Per Federal Schedule Variance 482,977, ,329, ,988, ,667, , ,774, (292, ) (294, ) (586,883.70) 274,188, ,518, ,518, Note 3a: Student Loans Processed and Administrative Cost Recovered Federal Grantor/ Program Name Department of Education Federal Family Education Loans (FFELP) Federal Perkins Loan Program (Perkins) Federal Direct Student Loans (Direct Loans) Health Education Assistance Loan Program (HEAL) Nursing Faculty Loan Program (NFLP) Health Professions Student Loan Program Nursing Student Loans Total Department of Education CFDA New Loans Processed 7,988, ,667, , ,774, *Admin Cost Recovered includes administration cost and any interest subsidy related to student loans processed. Costs Recovered* Total Loans Admin. Costs Recovered 7,988, ,667, , ,774, Ending of Previous Years' Loans 44,591, , ,156, Note 3b: Federally Funded Loan Programs and Administrative Costs Recovered Federal Grantor/ Program Name Environmental Protection Agency Clean Water State Revolving Fund (CWSRF) Drinking Water State Revolving Fund (DWSRF) Total Environmental Protection Agency CFDA New Loans Processed Admin. Costs Recovered Total Loans Processed & Admin. Costs Recovered Ending Balances of Previous Years' Loans Note 4: Depository Libraries for Government Publications The University participates as a depository library in the Government Printing Office's Depository Libraries for Government Publication program, CFDA # The University is the legal custodian of government publications, which remain the property of the federal government. The publications are not assigned a value by the Government Printing Office. Note 5: Unemployment Insurance Funds - Not Applicable Note 6: Rebates for the Special Supplemental Food Program for Women. Infants. and Children fwicl - Not Applicable
233 224 SCHEDULE 1A FOOTNOTES Note 7: Federal Deferred Revenue The deferred revenue is represented for federal grant prepayments that have not been earned and in cases where eligibility determinations have not yet been completed. Begin CFDA Balance Net Change End Balance CFDA Begin Balance Net Change End Balance (844.88) , , (50.78) , (3,683.82) , (1,152.49) , (268.07) 57, , , , , , , (39,923.13) , (59,233.16) 62, , , , , , , (187,401.33) 396, ,034, (475,774.15) 558, , (18,480.62) 40, , (2,000.00) , (380,763.88) 528, (209.44) , (340,815.12) 1, (223.05) , , , (24,047.96) 1, , (33,606.35) (2.53) (241.95) (252.85) , , , , (19,974.42) (0.04) , , , , , , , , , (34,656.24) 5, , , , (8,280.60) 16, , , , (12,512.54) , , , , , , , , , , , , (9,289.31) 24, (80.12) , , , , (291.30) , (97, ) 629, , (2,065.00) (89.71) , , , , , (20,363.00) , , , (1,654.92) , (2,019.00) , , , , , , (30,025.12) , (16,782.98) , , (0.20) , (7,162.13) , , , , , , , , (704.98) , , , (20.47) , , , , , , , , , , (18,995.66) 3, , , , (4,142.90) , (7,579.18) , (46,848.36) , (20,262.14) , (3,000.00) , (13, ) , , , , , , (56,555.22) 10, , (12,239.42) , , , , , (85,388.13) 33, Total 4,743, (1,592,089.55) 3,151, Note 8: SuE:E:Iemental Nutrition Assistance Program (SNAP}- Not Applicable
234 Schedule 1B- Schedule of State Grant Pass Throughs From/To Other State Agencies For the Year Ended August 31, 2013 Pass-Through from Other State Agencies Agency Agency# Fund# E&G Designated Auxiliary Restricted Total Texas Department of Public Safety 405 5, , Texas Department State Health Services , , , Texas Agrilife Extension , , Texas Water development Board , , , Texas Commission on Environmental Quality , ,731, ,055, Texas Education Agency ,782, ,395, ,177, Texas A&M University , , University oft exas System , , UT Southwest Med Center Dallas , , , Lamar University , , Cancer Prevention Research Institute , ,551, ,761, Texas Commission of the Arts , , Texas Higher Education Coordinating Board , ,009, ,058, State Energy Conservation Office , , Texas Higher Education Coordinating Board Technology Teacher Preparation Academies , , Outreach and Success , , NHARPAdmin , , TEXAS Grant Program ,168, ,168, College Work Study Program , , Top 10% Scholarships ,804, ,804, Texas State Board of Public Accountancy Fifth Year Accounting Student Scholarship , , "' CJ1
235 Schedule 1B- Schedule of State Grant Pass Throughs FromfTo Other State Agencies For the Year Ended August 31, 2013 ~ Pass-Through from Other State Agencies Agency Agency# Fund# E&G Designated Auxiliary Restricted Total Texas Agricultural Experiment Station Total Fire Ant Research , ,577, , ,383, ,156, ,117, The University of Texas at Austin Schedule 1B- Schedule of State Grant Pass Throughs FromfTo Other State Agencies For the Year Ended August 31, 2012 Pass-Through to Other State Agencies Agency Agency# ~# E&G Designated Auxiliary Restricted Total University of Houston , , The University of Texas at Brownsville , , The University of Texas MD Anderson , , The University of Texas at Tyler , , Texas Engineering Experiment Station , , The University of Texas Medical Branch Galveston , , Texas State University Total , , , ,085.37
236 SUPPLEMENTAL SCHEDULES 227
237 THE UNIVERSITY OF TEXAS AT AUSTIN SCHEDULE S-4a SUPPLEMENT FOR THE YEAR ENDED AUGUST 31,2013 N N co NACUBO NACUBO Indirect Cost Capital Transfers & Total Federal Source of Fund Expenditures Element Description Recoveries Earned Expenditures Adjustments Expenditures 02 INSTRUCTION AGENCY FOR INTERNATIONAL DEVELOPMENT 3, , , DEPARTMENT OF DEFENSE 32, , , DEPARTMENT OF EDUCATION 310, ,664, ,975, DEPARTMENT OF ENERGY ( ) (410.32) 02 DEPARTMENT OF HEALTH AND HUMAN SERVICES 123, ,969, ,092, DEPARTMENT OF LABOR 14, , , DEPARTMENT OF STATE 109, , ENVIRONMENTAL PROTECTION AGENCY (47.09) (313.96) (361.05) 02 LIBRARY OF CONGRESS 1, , NATL AERONAUTICS & SPACE ADMINISTRATION 53, , , NATL ENDOWMENT FOR THE HUMANITIES , , NATL SCIENCE FOUNDATION 68, ,600, ,668, NUCLEAR REGULATORY COMMISSION 8, , , INSTRUCTION 615, ,777, ,393, RESEARCH AGENCY FOR INTERNATIONAL DEVELOPMENT 100, , , , CORPORATION FOR NATIONAL AND COMMUNITY 63, ,361, ,424, DEPARTMENT OF AGRICULTURE 69, , , DEPARTMENT OF COMMERCE 738, ,297, , ,049, DEPARTMENT OF DEFENSE 22,036, ,797, ,500, ,334, DEPARTMENT OF EDUCATION 1,520, ,420, , ,967, DEPARTMENT OF ENERGY 11,043, ,185, , ,667, DEPARTMENT OF HEALTH AND HUMAN SERVICES 18,829, ,804, ,317, ,952, DEPARTMENT OF HOMELAND SECURITY 219, , , , DEPARTMENT OF HOUSING AND URBAN DEVELOP 4, , , DEPARTMENT OF JUSTICE 65, , , DEPARTMENT OF LABOR 112, , , DEPARTMENT OF STATE 7, , , DEPARTMENT OF THE INTERIOR 391, ,167, ,559, DEPARTMENT OF TRANSPORTATION 431, ,272, , ,707, DEPARTMENT OF VETERANS AFFAIRS 48, , , , ENVIRONMENTAL PROTECTION AGENCY 737, ,046, ,784, GENERAL SERVICES ADMINISTRATION 125, , , LIBRARY OF CONGRESS (10.36) (1 0.36) 06 MISCELLANEOUS FEDERAL (16,536,559.58) 16,536, NATL AERONAUTICS & SPACE ADMINISTRATION 4,104, ,469, , ,979,879.68
238 SCHEDULE S4A SUPPLEMENT CONT. NACUBO NACUBO Indirect Cost Capital Transfers & Total Federal Source of Fund Expenditures Element Description Recoveries Earned Expenditures Adjustments Expenditures 06 NATL ENDOWMENT FOR THE HUMANITIES 27, , , NATL SCIENCE FOUNDATION 19,285, ,555, ,864, '705, NUCLEAR REGULATORY COMMISSION 42, , , OFFICE OF PERSONNEL MANAGEMENT , , UNITED STATES INSTITUTE OF PEACE 8, , , RESEARCH 80,014, ,477, ,140, ,633, PUBLIC DEPARTMENT OF AGRICULTURE 5, , , SERVICE DEPARTMENT OF COMMERCE 4, , , DEPARTMENT OF DEFENSE 6, , , DEPARTMENT OF EDUCATION 425, ,614, , ,057, DEPARTMENT OF ENERGY 5, (831,154.91) 1,256, , DEPARTMENT OF HEALTH AND HUMAN SERVICES 282, ,399, ,681, DEPARTMENT OF HOMELAND SECURITY 24, , , , DEPARTMENT OF HOUSING AND URBAN DEVELOP 58, ,064, '122, DEPARTMENT OF JUSTICE 33, , , DEPARTMENT OF STATE 98, , , DEPARTMENT OF THE INTERIOR 4, , , ENVIRONMENTAL PROTECTION AGENCY 23, , NATIONAL ARCHIVES & RECORDS ADMIN 72, , , NATL AERONAUTICS & SPACE ADMINISTRATION , , NATL ENDOWMENT FOR THE HUMANITIES 43, , , NATL SCIENCE FOUNDATION 126, , , PUBLIC SERVICE 1,193, ,976, ,278, ,448, ACADEMIC DEPARTMENT OF EDUCATION 63, '175, ,238, SUPPORT DEPARTMENT OF ENERGY 75, , NATL SCIENCE FOUNDATION 46, , , , ACADEMIC SUPPORT 109, ,313, , ,526, STUDENT DEPARTMENT OF EDUCATION 64, , SERVICES STUDENT SERVICES - 64, , INSTITUTIONAL DEPARTMENT OF EDUCATION 91, , SUPPORT INSTITUTIONAL SUPPORT - 91, , OPERATION & DEPARTMENT OF HEALTH AND HUMAN SERVICES 2, , , MAINTENANCE OF PLANT OPERATION & MAINTENANCE OF PLANT - 2, , , SCHOLARSHIPS DEPARTMENT OF DEFENSE 38, , , AND DEPARTMENT OF EDUCATION 12, ,834, , ,136, FELLOWSHIPS DEPARTMENT OF ENERGY 50, , DEPARTMENT OF HEALTH AND HUMAN SERVICES 10, ,818, ,829, DEPARTMENT OF TRANSPORTATION 82, , I'.) 48 ENVIRONMENTAL PROTECTION AGENCY 119, , I'.) CD 48 MISCELLANEOUS FEDERAL (37,754,004.02) 37,754, NATL AERONAUTICS & SPACE ADMINISTRATION 7, , ,715.15
239 230 THIS PAGE INTENTIONALLY LEFT BLANK
240 SCHEDULE S-4A SUPPLEMENT CONT. NACUBO NACUBO Indirect Cost Capital Transfers & Total Federal Source of Fund Expenditures Element Description Recoveries Earned Expenditures Adjustments Expenditures 48 NATL ENDOWMENT FOR THE HUMANITIES 80, , NATL SCIENCE FOUNDATION 19, ,419, ,438, NUCLEAR REGULATORY COMMISSION 42, , , WOODROW WILSON INTL CTR 44, , SCHOLARSHIPS AND FELLOWSHIPS 131, ,623, ,043, ,797, AUXILIARY DEPARTMENT OF EDUCATION 96, , ENTERPRISES AUXILIARY ENTERPRISES - 96, , Summary 82,064, ,424, ,537, ,043, ,070, ~ "'
241 Schedule S-8 Recap- Schedule of Changes in Fund Balance Unexpended Plant Funds For the Year Ended August 31, 2013 r-.:j w r-.:j ADDITIONS DEDUCTIONS BALANCES AUGUST Gifts and Interest and Investment Transfers and Expenditures Not Orders and Contracts Balances ~ Income Adjustments Capitalized Land Buildings Equipment Intangible Assets Total Expe11ditures Total Outstanding Balances Reappropriated From Permanent U11iversity Fund Bonds/Notes (1 045,326.52) ,015, , , , ( ) , ( ) From Available University Funds 12,106, ,971, , ,026, , , From Interest Earned on Construction Funds 10,362, ( ) (16,274.49) 2.566, , ,649, From Revenue Bonds/Notes 31, ,243, , ,987, ,002, , , , ,570, From Federal Grants From Private Gifts ,278, , , , , , ( ) (25 033,250.85) From Other Sources Other 99, , , , ,557, , ,644, , From Other Sources- Auxiliary Enterprises 49,512, ,163, ,278, ,684, , , ,887, ,788, , Total from All Sources 206~}41L 5,697, , ,411, ,232, , ,502, ,809, , ,801, ,101, ,240, , Interest and l11vestment Transfers and Footnotes ~ Adjustments lntrafund Transfer- Set Up Project lntrafund Transfer- Lapse Funds Transferred From/To System Administration (Sch. B-13) Transferred From/To System Administration. ROI (Sch. B-13) Tra11sferred From/To SeNice Department Funds (Sch. B-13) Transferred From/To Designated Funds/Other (Sch. B-13) Transferred From/To Educational Projects and Programs (Sch. 8-13) Transferred From/To Auxiliary Entarprises (Sch. B-13) Transferred From/To Restricted Funds (Sch. B-13) Interest on Short Term Investments in the Fair Value of Investments Totals 5,697_,Z77.Q1.. 1:3:3.:U$
242 Schedule S-11 a- Schedule of Changes in Investment in Plant- Land For the Year Ended August 31, 2013 Carryinq Value Fundinq Source Description Main Campus CAMPUS (ORIGINAL 40 ACRES) ESTIMATED VALUE 100 WEST 26TH STREET 1616 GUADALUPE 1907 GUADALUPE 19TH AND RED RIVER (OPEN STORAGE AREA) 2000 RED RIVER (JOSEPH PROPERTY) 2006 LEONA STREET 2108 CONCHO STREET 2112 LEONA 2200 EAST SIXTH STREET (LORENZ PROPERTY) 2200 RED RIVER (MILLER PROPERTY) 2204 LEONA STREET (HALE PROPERTY) AND SAN ANTONIO STREET 2500 GUADALUPE 2500 WHITIS 2506 WHITIS 2512 WHITIS (PARRISH PROPERTY) 2600 WHITIS (GARRISON PROPERTY) WICHITA (PUETT PROPERTY) 2610 WHITIS (KERBY PLACE LOTS) 2612 WHITIS AVE (SCARBROUGH ESTATE) 2815 SAN GABRIEL (IC2 INSTITUTE) 29011H MLK & 1902 WHITIS ACQUISITION 304 WEST MLK ACQUISITION 305 W 20TH & 1908 WHITIS 702 EAST 26TH ST FRANK DOBIE) EAST URBAN RENEWAL ELEMENTARY SCHOOL LAND- HIDALGO/ MARTINEZ GIFT FROM GEORGE W. LITTLEFIELD-EST. VALUE HOTEL, CONFERENCE CENTER & GARAGE SITE KINSOLVING LAND ACQUIS. LITTLEFIELD HOME SITE ESTIMATED VALUE MEDIANS IN 1900 & 2000 BLKS-UNIVERSITY AVE PARKING GARAGE II SITE Main Campus Total Permanent Available Interest Earned Size in Carrying Value Carrying Value Legislative University Fund University Revenue Federal or Construction Year Acquired ~ Additions Transfers Adjustments Enactments Bonds/Notes Funds Bonds/Notes Grants Private Gifts Funds Other Sources , , ~ , ,626, , , , , , ,277, ,232, (113,125,00) (113,125.00) 15, , , , ,396, , ,339, , , , , , , , , ,127, , ,500,00 1,885, ,319, ,620, ,745, ,464, ,584, , ,300.'00 25, , , , , , ,937, , , , , ,201, , , , ,000,00 22, ,986, ,400,00 2,294, ,887, , , , , , ,934, , , , ,921, ,966, Bastrop County 401 OLD ANTIOCH ROAD (LORRAINE STENGL) Bastrop County Total , , , , , Bonham SAM LIBRARY Bonham County Total 1991,96 ~ , , , , Harris County WEST LITTLE YORK RD (BP SITE) Harris County Total 2012 ~ , , , , Jeff Davis County MCD- ADJOINING TRACT- ESTIMATED VALUE MCDONALD OBSERVATORY (MCD)- MT LOCKE TRACT- ESTI~ MCDONALD OBSERVATORY SITE- REBECCA GALEVISITORS I Jeff Davis County Total ~ , , , , , , , , Medina County DEVINE TEST SITE Medina County Total Midland County BEG-CORE STORAGE FACILITY Midland County Total QQ _, , , , , , ' =- 400, , '- 10, , , , N w
243 1\) ~ The University of Texas at Austin Schedule S-11a- Schedule of Changes in Investment in Plant- Land For the Year Ended August 31,2013 Carrying Value Fundln Source Description Year Acquired Size in ~ Carrying Value Additions Transfers Adlustments Permanent Avaltable Interest Earned Carrying Value Legislative University Fund University Revenue Federal or Construction Enactments Bonds/Notes Funds Bonds/Notes Grants Private Gifts Funds other Sources Nueces County MARINE SCIENCE INSTITUTE- MARINA-CITY BY THE BAY TRA MARINE SCIENCE INSTITUTE- MCNAMARA TRACT MARINE SCIENCE INSTITUTE (MSI)- ORIGINAL TRACT MSI-FAM.L. MSI- FRY TRACT (WILSON COTTAGES) MSI-LUND TRACT MSI- NELSON TRACT NUECES COUNTY PROPERTY (HEW) TWO TRACTS Nueces County Total , , , , ~ 100, , , , , , , , , , , QQ&QQ:2Q 387, , , ,000,00 16, Travis County MANOR ROAD 61ST LEG E OFW. 51ST & N. GUAD. 61ST LEG CONFEDERATE HOME W. 6TH ST BRACKENRIDGE APARTMENTS SITE BRACKENRIDGE FIELD LAB SITE COLORADO APARTMENTS SITE DOBIE PAISANO RANCH (RAWHIDE TRAIL) LADY BIRD JOHNSON WILDFLOWER CENTER LAKE AUSTIN CENTRE BUILDING SITE LAND PORTION OF REGIONAL RADIO SYSTEM MONTOPOUS RESEARCH CENTER (DATA GEN'L SITE) NIKE-HERCULES LAUNCHER SITE (BEE CAVES) PROPERTY ADJACENT TO PICKLE RESEARCH CAMPUS RED BUD TRAIL STRIP STEINER RANCH THE J.J. PICKLE RESEARCH CAMPUS ESTIMATED VALUE Travis County Total , , , , , , , , , , ,032, , , ,096, , , ,029, ~ ,138, , , , , , , , , , , , , , , ,032, ,032, , , , , ,096, ,096, , , , , ,029, ,029, ~ 14,138, ,422, ,142,044,62 71, ,151, , , Uvalde county 333 N PARK STREET (GARNER PROPERTY) Uvalde County Total 2000 ~ , , Total land (Sch. B-11) ~ 89,731, , (113,125.00) 94, , ,003, , ,283, Reduce lease continqency fee related to land purchase Total (113,125.00) (113,125.00) Beginning balance for 304 West MLK Acquisition has been adjusted for $0.01 for prior year activity Summarv of Additions Additions per S 11a Schedule (B-11) Current Year Additions Made Up as Follows: Education General Funds Designated Funds Auxiliary Funds Restricted Current Funds Unexpended Plant Funds Gifts for Capital ACQuisitions Other Adjustments Total Additions 2,326, , ,232,063.18
244 Schedule S-llb -Schedule of Changes in Investment in Plant - Buildings For the Year Ended August 31, 2013 BRACKENRIDGE FIELD LAB- SMITHVILLE, TX Description Carrvinq Value Depreciation N w ()1
245 Schedule S-llb -Schedule of Changes in Investment in Plant- Buildings For the Year Ended August 31, \.) w Q) MAIN CAMPUS CONTINUED Carrying Value Depredation
246 > ""'49;3'12,402.87' The University of Texas at Austin Schedule s~ llb Schedule of Olanges in Invesbnent in Plant - Buildings For the Year Ended August 31, 2013 MAIN CAMPUS CONTINUED Description 1it.oiNG;.8ERNARD"& ru:brary'(bonham; FANNINCOiJNTY.'liXAS)''""'"'""'"P ~wnnn,v/nq' :oi66 IDAs'MeMORIALMUSeUM' 'TEXAS's.wiMMiNG"CENTER,\~EE & JOEJAMAIL., tfliermai. ENERGVSTOiAGit""" '~'' "'''' 'llffi'mpson'oon'ferencednter; JOitC:.. itownes''halc''''''"" ' _..., '""''"'"" "" 'Y'' ; unners'riy tnrersi::holasticteague suriliing===== WNiVERsfrY PoucE BurLDING'""' UNIVERsiiY"TEACH.iNG 'CENTER ' ' "' UTADMrNrSlRATION euilding"'" ;WAGGENER'HALL.!\NiAVERPOWER PLANT"ANN.Ex, HALe:=""""'"' ;WEAVER"POWER'PLANT EXPAN5iDN;"HAL"2~~=W-'""" " tweaver"power.plant;'hal'c:.,...,,,. v i:-~~~~i&~~~:r,;.~;.,:::~~~ ;west MALl OFFIC'E'BtiiloiNG ;WiNSHiP'DRAMA suxujing~'f.'lore~n ~""" ~WOOLRicii'lAeoRATCiRIES, w3c'="~"" '==w \MAiN'CAMPUs TOTAL"""".,,,.M = =w=v""" "' MARINE SCIENCE INSTITUTE PORT ARANSAS,MUSTANG ISLAND Description i ;ANIMAL ReHAB: KeEP.(ARK)"'"A :seach streetaparrments """ cca nd.ab FOR MARtNitl1RViCliL11JRE : oormitorv"d'"' '"""", F:A:M.L. MAitJTAs BUIL"DING'"' '!laborai-oiiy"i:iarifief'"a""'"" '" "" fi.;afn ADMiNiSfRAffQN 'BLiiloiNc{'"== m ;MAii:tWETAND.ORYLABORATORY'BUfiliiNG"""A'., tnerrheadquarfus & RESEARci:i'"BullDING '='"' ;NciRiHBoATHOUSEA>~"",,N.. '"""""'""" l ~' "t44,03a 77,632. N'~'i~,~1~~7?~.~ 9;oii5">,-- ''i4~063'"'''" 102, "t?4s: = - "'""'=~~h~?:.~.:~;. x 24,759( ~ 1,234, ; 47,794.,.""'ii07,8oa.sa,:~,101 "'"18,6~:~.:?.~:~, 712, :::::~~~:~~I~~::::,o8" ~!~;?2~~~~ 11,559,751.89: 337, ~"'2:5Se ;a4i.69 ;"" W" < vz:olto3,,~mn»>>=»i76tlii09 ""'1;539,"923:91 " =99)60.03 ' '= =i,bu.:s37:99 ;"" """"""""2:'is';SOS:i5 ; =1;94{290:-ss ' ' ""'"""Ti33S4.71, ''~~~:~~~~;?~.,.. ~.!,~iici;g?a~~! ' )'8i7fele.Sci:i'PEOOMe euiioing ADDiTIONAL STAFF HOUsiNG'' ;Eoi:iCATION.CENlliR"fuESC:OPEDoMe l ~education CENTER~TEL&OPEDO'ME' 2"' ;FRANK "N. BASii"VISITORS"CeNTER.AT Mi::OoNALD L~!LANJ:'i~trH ~~-~~:(::>~07J0~ ~~~I:::.. N ~
247 Schedule 5-llb ~Schedule of Olanges in Invesbnent in Plant~ Buildings For the Year Ended August 31, 2013 N w CXl MCDONALD, W.J. OBSERVATORY(MT. LOOKE JEFF DAVIS COUNTY) CONTINUED Desc:rlptlon Carrvina Value Depreciation :W."CMCiODY,JR.'ViSITORSCENTER"'' i~~~~~~;\v~~~~~~~~.~!~~~.~~~~=~~~ DAVIS COUN~f~!~~ ~ i PHYSICAL PLANT COMPLEX k...w.~~ ''"=~m.». y,v >.w..» <FACILmES COMPLEX BUILDING 1 Desc:riptlon ~FAc:n1TIESNCOMPLEX" BUiLDING'i~'~~ '""''",.., N=w~." v.w.v.>.m> t FAciiTIES'CO'M'PLEitB"Uil.DiNG 3' t~~~~~~,~~~~~"~~~~-~-~0~. ~~~N===m '-FACILIDES COMPLEX BUILDING 6!:~f~~::t~"!Oi-~{:~ : ;PHYSiCALPLANTCO'MPi.Ex rotac' "M "'""" '"'' J.J. PICKLE RESEARCH CAMPUS Desc:ription ~APPUEDRESEARCH'LABORA"'TORiES'':M"Jii.tBUILOiNG (PRc 35)""'''''"'. tapptieo"reseafich LAs oratoiues.:"mct<inneywi"f:jg(prcioo)="""'="~~,. 'AAl ASSEMBLY&'TESTiLOG (PRCi93)'" c, Nh ~~t~~::~~~~;~mtcs'(prc7)'h""wffergtj:sq'n LABORA'TORV'~' MAJN" iiliiti)jng"(prc'24)~m"---~ ~~~~~pr!~~~~~~;,r~~~~~~~;~"'~:s"',!"!.-v -,, ~HOUSTON CORE RESEARCH CENTER WAREHOUSE ''IMAGING'RESEARCHCENTER(PRC"l97) A'., ""'~ '" ' ' 'h"h ~=== C J. NEilS THClMPSON"COMMONS(PR2137)'"" "Vo "" O 'UBAARVHIGHDENSITY'REPOSITORY(PRFi76A)' "'""--~,.,. >W'h~Wh~~~~~="»~~ ieaii'eng:rneering"idching tab (PRCTh~l ~ "'""' ;pfiejt~.f/ser~~~s~(recnfie~~, (PRC'~)"",.~~~~~~, (PiC central CHILLING station (PRC iz9)n--== PRCCHEMICA""L SrciRAGE BLoG(P'RC 'iss)'',. i~::??~lf~~e~jfj J?~f,_. ~.., '""~.,,.:::~.w.~.",.'",,'."''''"'"~..,h,,.,m~m~w),.:;. :::;';:, WRC UBRARY STORAGE FACIUlY (PRC 176)!PRC PHYSICAL'.PLANTADMINISTRAnoN '(PRC'is)~, :PRC PHYsiCAL'PLANTWAREHOTJSE"(i>Rc 45) tt ~~~ ~~~~;~~?~~5fk~~~~::~"~""'" c
248 Schedule S-11b -Sd1edule of Changes ln Investment in Plant- Buildings For the Year Ended August 31, 2013 J.J. PICKLE RESEARCH CAMPUS CONTINUED Carrying Value Depreciation Description Bldg Nbr G~oss Square Footage Beginning Value Transfers Adjustments Dispo,;als Ending Value Beginning Accumulated Depreciation Additions : Transfer,;i Adjustm-en-ts ---J Dlspo$als Ending Accumulated Deprt~clation Net Book Valu"' 0962 UT ELEMENTARY SCHOOL Description Bldg Nbr: Additions Transfers[ Adjustments ~-Disposals Ending Value Additions I Triinsferro{ Adjustments _2_4_,_~~~:~~-: ' 289, , UT ELEMENTARY SCHOOL GYM 73;isl'i:02' '3'6i15.,_ UT ELEMENTARY SCHOOL THIRD GRADE BUILDING UT ELEMENTARY SCHOOL TOTAl {20;644'~51'}''"' OTHER LOCATIONS Descdption BEG HOUSTON RESEARCH CENTER (11611 W LITTLE YORK RD) BUREAU OF ECONOMIC GEOLOGY CORE STORAGE WAREHOUSE BUREAU OF ECONOMIC GEOLOGY SHOP (S310 A BUSINESS I-20 E) Bldg Nbt' Beginning Value Additions Adjustments 1 OJiopO~;.il'l e nd~:p~:~::~!ilted -T l NBt-SOoTV.iiUt : l,+m,2i5~'98 ' sj,uz:04 242, JD'HN NANCE- GA-RNER HouSE AND MUSEUM OTHER locations TOTAL 131, l,s7s',ssi.73 N 0.) (0
249 The University Of Texas at Austin Schedule Sw llb -Schedule of Olanges In Investment in Plant w Buildings For the Year Ended August 31, 2013 ~ 0 DORMITORIES ~Ai.METRiS.DUREtJ'RESIOiNCe HALL""" lanoiews"'dor.mitory- ''h'"«'>"=', >-BLANTON DORMiTORY fbra&enr:rdgi:"hau DORM'iTORv. \:~ ~~~~ ~OQRM~-~ ~'v""~:~~~-.~~ ~CREEKSIDE RESIDENCE HALL 'ifster oormitory" ~~ " ~~= :: ~~it~:.. v.~~ m" : :~==..~:: '\MNG'LEAANiNhG'HAU.A"'~''" ' uvinglearnlnghal'i:'b' uving.'learn.inghallvc UViN"G LEARNiNG 'HALL 0 ;lmng.learning"hau. E tuvfng i.earning'h"au:" F {MoORe-Hri.i. '6CrRMimRY ~PRATHER HALL DORMrroRY~~~w" i~~~er~:~~~~~?~~~ft '~~~-:, t.~~ -~~9,~~~~~10~~-:E HALL!DoRMITORIES TOTAL Notes: Beginning Balance, , as previously reported Add: Additions (S-lle) Book Value of Plant. 8w31-13 Carrying Value Description Additions jtransfers! 3,093,997, ,758, ,352,756, '" ~:~.~h~~~.~!.:~n~l99 Lw. ~:?~~'~.?,9S4.4Sc! ' 13,466,523:17' >-~:t~-t~i~r;,..,.. ~!~~6!~~~Tf. 1,304,147.04: -1,oi0,9111:i6"\' Net Book Value Beginning Accumulated Depreciation Balance, 9wQ1w12 Add: CUrrent Year Depreciation Expense Adjustments Acrumulated Depreciation 8-31~13 Net Book Value of capital Assets, 8w31w13 1,373,557, ,631, ( ) 1,510,476, ,842,279, Footnotes: Title Changes: Title change for McCombs School of Business to College of Business Administration Title change for Applied Computational Engineering Sciences to Peter O'Donnell Jr. Building Adjustments to carrying Value: $15,533, as part of Nonnan Had<ennan Building (NHB) In prior years has been moved to Robert A. Welch Hall (WEL). $630, as part of the UT Elementary School Administration Building has been moved to the ljf Administration Building (UTA). Adjustments to Depreciation: True up of acwmulated depreciation
250 Schedule S-11c- Schedule of Changes in Investment in Plant- Facilities f Improvements For the Year Ended August 31,2013,... LAKE,,.., AUSTIN,... CENTER,_-g N -!>- ~
251 ~ N The University oft exas at Austin Schedule S-11c- Schedule of Changes in Investment in Plant- Facilities /Improvements For the Year Ended August 31,2013 M6:11'1 (:7(t;lp0s BONTINUED r,,,,,...,,,".. ~"'~"- ".vuvh&;;"(ipti;;;;-=u, mnn"additions Carrying Value T;;~;;i~;~ TA.iNiNG>NALL. POoLS - GWEGOR tgymnasium AaUATIES EOMPLEX' ~"LANoscAPiNG~'RErAtNI.NG 'wafls.fencu.. jg,':'norih EN'D zone"" ~ UNiVfRSfTYAVENiiE'iMPRovE.MENTS~-"< ~"". l walle R C'REEK.iMPROVi:MeN rs,,,,.,./,~"m"~/,.y,"''' ' ~ welchnorth PLAZA WATERPROOFING AND~$[}RFACE MATERIAL f WESTEN'[) OF CAM'PiJs ~ RED'ES:iGN'v.~= '" Y rma!~~~.~p~~ fof~f:~~-~ - "' - "~"""''"""~'',, f R'ESEARCHPtER '"~~~"'" ' r:!~~~mn~~~~:~!~~r"'"',h.. ::. :::=~:~::.~..::.:.: ::::: ' i 'MARINe ~~!-~ICA~ CA~~~ :? ~~-~~~~N-Es?T~~~)~~ffi~re ~G' JsLANDi.fOTAL~'~, -~:.,~,~02,645:~~], 0 475,000.00{ ~'" ''<.',,~;~~~~~~y't'' J.J. PICKLE RESEARCH CAMPUS '.~... ~~-mm~';;rfj;tio'n BRAKER LANE ENT'RANCE~~' t Lt.:NDSC'APli m,, LANOSC.APJNG. FENCING. PARKING. &'rrails': FtESEAWCH'OFf:JCE COMPLEx BUILDING"'"'"", " j LANDSCA.PJNG, 'FENCiNCi PARkJN'i:i'&.. TR A Jl.'S'-'RESEARcH 6FfJcE CoMPLEX SUPPORYBUfCDTNG LANDSC'A.PING:'PARKING LOT -'LIB'RARY AND ARriF'Acr'HiGH.DENslrY REPOSiTORY~"""..,.,.,,,,,_., ) PAR'KINC3'LOT., ' m "''"m.v.. ' ' ' '..., ~'"'" rw~s~'frac''f.~ld'en TRJAN~~~.~~REEMENT" G:(~!~~~:~ ~R~~C~M~~~:~?~?\:~~:.~:..~N=~ ~w.~.. ~~ '
252 Schedule S~ 11c ~Schedule of Changes in Investment in Plant- Facilities f Improvements For the Year Ended August 31, 2013 ADXiCiJiffy-Ei'J"TffiPRISES PLANT Description TOTAL FACILITIES AND OTHER IMPROVEMENTS {SCH. B-11) 8,788, Notes: Beginning Balance, 9~01~12, as previously reported Add:Additions (S~ 11e) Book Value of Plant, Beginning Accumulated Depreciation Balance, Add: Current Year Depreciation Expense Adjustments Accumulated Depreciation, Net Book Value of Capital Assets, ,011, , ,242, ,950, (106,202.76) 157,087, ,713, Adjustments to Depreciation True up of accumulated depreciation "' ~ w
253 Schedule S-110- Schedule of Changes in Investment in Plant- Equipment For the Year Ended August 31, 2013 ~ -1>- CARRYING VALUE DEPRECIATION Description Balance 9/1/12 Additions Disposals Adjustments Transfers Balance 8/31/13 Total Total Depreciation Depreciation Depreciation Depreciation Depredation Accumulated Beginning Balance Expense Disposals Adjustments Transfers Depreciation Net Basis DESKS TABLES CHAIRS PERSONAL FURNITURE:BED, DRESSER, ROCKER CASES & CABINETS OTHER OFFICE FURNITURE VEHICLE MAINTENANCE EQUIPMENT PHOTOCOPYING EQUIPMENT FAX MACHINES STEREO SYSTEMS CAMERAS VIDEO RECORDERS/PLAYERS OTHER SOUND SYSTEMS/ EQUIPMENT MUSICAL INSTRUMENTS RECREATIONAL EQUIPMENT VIDEO CONFERENCING EQUIPMENT GPS EQUIPMENT OTHER ASSETS WAREHOUSE EQUIPMENT: FORKLIFT MAILROOM EQUIPMENT INSTRUCTIONAL EQUIPMENT CONVEYER SYSTEMS DRILLS, STAIONARY GRINDERS, STATIONARY LATHES, STATIONARY HEAVY (MAJOR) EQUIPMENT MILLING MACHINES PALLET TRUCKS, LIFTS, JACKS, HYDRAULIC SAWS, STATIONARY SCALES SHAPERS, JOINERS, PLANERS, STATIONARY SHEARS TEXTILE MACHINERY WOOD WORKING MACHINES, OTHER, STATIONARY TOOLS AGRICULTURAL EQUIPMENT OFFICE MACHINES MISCELLANEOUS MACHINES WEATHER EQUIPMENT PRINTING MACHINE & BOOKBINDING EQUIPMENT KITCHEN APPLIANCES & EQUIPMENT LAUNDRY EQUIPMENT BUILDING MAINTENANCE & SAFETY EQUIPMENT PORTABLE BUILDING OTHER FURNITURE & EQUIPMENT SUPERCOMPUTER MAINFRAME MINICOMPUTER, SERVERS MICROCOMPUTER-DESKTOP CPU-NOT APPLE DISK DRIVES PRINTERS TERMINALS, MONITOR DISK CONTROLLERS 226, S44,S34.S3 82,8S0.33 1,390, ,147, , , S4,08S.79 24, , ,566, ,9S0, ,349,S ,051,S , ,958, ,926,00S ,318.2S 624, ,6S , ,449, , , ,133, , ,782, , , , ,91S.OO 31, S, , , S, ,354, , ,S23, ,7S2,310.S2 121,438.S1 781,930.7S 11,674, ,661,23S.29 25,191, , ,350, ,684, ,222, ,470, , ,2S1, ,198.S4 8S, , , , , , , , S, ,38S, , ,S , , , , , S, , , , , , , , , ,3S1, ,713.4S 1, , , , (8,029.79) (17,38S.S6) (14,300.00) (46,156.02) (336,S07.91) (91,000.23) (2,132,600.11) (497,329.00) (50,121.00) (221,425.48) (4S,415.00) (6,395.00) (6,410.00) (44,539.00) (175,606.47) (165,915.09) (5,199.00) (S3,027.81) (11,927.00) (48,985.34) (1,94S,710.34) (75,313.00) (112,879.79) (119,737.99) (332,126.58) (213,295.00) (42,012.10) (6,727,023.20) (S,771,466.23) (247,129.28) (236,840.73) (51,552.60) (248,910.50) (2,887.85) (118,890.75) (24,830.16) 2, , (0.00) (16,078.00) 8, , , , (2,027.68) 31, , , (939.43) (84,593.00) 5, (34,753.79) 30, (5,093.33) 93, (5,651.27) 149, , , ,390, ,162, , , , , , ,596, ,174, ,727, ,614, ,642, ,344, ,197, , , , , ,480, , , , , ,976, , , , , , , , , , , ,517, , ,496, ,861, , , ,721, ,324, ,992, , ,099, ,569, , ,277, , ,825, , , , , ,886, , , , , , ,698, ,953, ,762, ,855, , , ,567, , , , , , , , , , ,182, , , , , , , , , , ,223, , ,393, ,753, , , ,444, ,292, ,317, , ,409, ,714, ,127, ,064, , ,362, (6,576.71) (75,591.72) 1, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,675, , ,227, , , , , , (8,029.79) (17,385.S6) (14,300.00) (33,3S8.02) (336,S07.91) (88,97S.75) (1,797,474.48) (497,329.00) (44,273.S4) (0.00) (121,793.81) (2,679.67) (37,781.24) (6,39S.OO) (6,410.00) (41,902.8S) (128,312.06) (137,399.33) (1,126.4S) (53,027.81) (11,927.00) (33,116.29) (1,395,567.4S) (75,313.00) (40,342.38) (89,202.99) (257,921.16) (213,295.00) (42,012.10) (6,358,147.27) (5,645,996.07) (247,129.28) (226,784.18) (51,SS2.60) (S6,175.80) (2,8S6.00) (84,593.00) 117, , , , , ,917, , , , ,007.0S 210, (30,471.65) 5,822,409.2S 26, (2,504.22) 209, (5,651.27) 2,1S4,796.S9 10,358, ,457, ,2S1.68 1,380,7S2.00 1,609, ,43S , , , , , , , , ,203,2Sl , , ,6S ,S27.S7 21, , , , S, , ,340, , ,370, ,978, , ,7S ,S11, ,099, ,779, , ,488, ,639, ,548.SO 1,9S6, , ,770,S , , , , ,214.6S 12, , , , ,773, ,020, ,369, , ,226, ,963, , S, , ,229.SS 144,S01.8S 1,298, , , , , , , , , , , , , ,S , ,176, , , , , , , , , , ,611, , , , , ,055,
254 Schedule S-110- Schedule of Changes in Investment in Plant- Equipment For the Year Ended August 31, 2013 CARRYING VALUE DEPRECATION Description Balance Balance 9/1/12 Additions Disposals Adjustments Transfers 8/31/13 Total Total Depreciation Depreciation Depredation Depreciation Depreciation Accumulated Beginning Balance Expense Disposals Adjustments Transfers Depreciation Net Basis OTHER COMPUTER HARDWARE CPU DESKTOP-APPLE DATA PROJECTORS PALM PILOTS, OTHER HAND-HELDS SECURITY SYSTEM-NOT BUILT IN IMAGE SCANNER BARCODE SCANNER POWER SUPPLY, BATIERY, GENERATOR UNITERRUPTIBLE POWER SUPPLY MODEMS & RELATED DEVICES DIGITAL AND CHANNEL SERVICE UNITS MULTIPLEXORS COMMUNICATION CONTROLLERS PROTOCOL CONVERTERS VSATS DATA COMMUNICATIONS DIAGNOSTIC SYSTEMS OTHER COMMUNICATIONS HARDWARE LAN/WAN SWITCHING-HUB, SWITCHES & ROUTER COMPUTERS EQIUPMENT RACKS, SHELVING PORTABLE CPU-NOT APPLE PORTABLE PRINTER PORTABLE APPLE CPU AMPLIFIERS, ALL TYPES ANALYZER, ALL TYPES AUTOCLAVES AND STERLIZERS BALANCE BATHS, WATER AND SHAKERS ANIMAL CAGES AND ACCESSORIES CENTRIFUGE CHROMATOGRAPH CRYOSTAT COUNTER LABORATORY ASSEMBLY DENSITOMETER ELECTRONIC MODULE ELECTROPHORESIS APPARATUS EVAPORATORS FRACTION COLLECTOR FREEZE DRYERS AND ACCESSORIES FREEZER, LAB HOMOGENZIER HOOD, ALL TYPES INCUBATORS AND ACCESSORIES ISOLATOR MICROMANIPULATOR METERS, GAUGES, INDICATORS MICROSCOPES AND ACCESSORIES MICROTOMES, DIAMOND KNIVES, SHARPENERS OPTICAL EQUIPMENT OSCILLOSCOPES OVENS AND RANGES, LAB PUMPS RECORDING SYSTEMS REFRIGERATORS, LAB 5,467, ,668.S1 2,416, S, ,324, ,499, , ,342, ,760.S8 194, ,31S , , , , ,171, ,323, ,425, ,420, , , , ,19S, ,388,33S.37 S41, , , , ,258, ,565, , , , , , , , , ,702, , , ,189, , , ,501, ,915, , ,213, ,044, ,049, ,598, , , , , , , , , , , , , , , , , ,321, , , , , , , , , , , , , , ,977, , , , , , , , (905,866.06) (93,407.28) (202,722.24) (1,051,738.09) (132,398.95) (233,533.60) (2,806.00) (16,894.71) (67,645.50) (1,828,292.00) (733,486.64) (1,907,371.59) (177,955.04) (79,666.51) (24,918.90) (13,713.25) (690,377.76) (41,721.26) (1,627.54) (2,000.00) (56,150.41) (187,450.19) (7,123.05) (18,481.85) (47,751.00) (40,366.50) (5,869.47) (13,580.00) (22,285.94) (5,800.00) (189,915.84) (136,376.35) (93,883.23) (267,082.86) (5,212.00) (168,086.98) (20,860.00) (5,905.00) 14, , (22,000.00) 6, , , , , (5,380.00) 2, , , , (10,015.00) 71, , , , , , , ,252, (39,796.98) (8,900.00) 47, (31,000.00) (6,089.00) (1,165.18) (129,206.14) (252,433.36) (15,891.58) (22,391.59) 5,072, , ,948, , , ,626, , ,243, , , , , , , , , ,883, ,600, ,202, , , , ,175, ,065, , , , , ,609, ,623, , , , , , , , , ,896, , , ,355, , , ,830, ,990, , ,667, ,799, ,072, ,758, , , ,108, , ,332, , , ,262, , ,761, , , , , , , ,069, , 790, ,430, , , , , ,026, ,903, , , , , ,916, ,973, , , , , , , , , , , , , , , ,874, ,629, , ,095, ,049, ,852, ,836, , , , , , , , , , , , , , , , , , , ,537, , , , , , , , , , , , , , , , , , , , , , , , , , , ,034, , , , , , , , (339,354.45) (88,362.28) (112,398.12) (444,416.58) (132,449.87) 0.00 (171,324.53) (2,806.00) (16,894.71) (67,645.50) (1,828,292.00) (480,411.18) (1,739,290.44) (131,637.39) (76,816.00) (27,720.98) (13,344.64) (619,566.23) (41,721.26) (1,356.28) (106.06) (49,602.51) (183,301.10) (377.74) (18,481.85) (37,261.28) (38,444.28) (5,869.47) (13,580.00) (10,081.94) (5,800.00) (187,693.53) 321, (93,883.23) (205,222.56) (5,212.00) (157,606.19) (6,953.33) (5,905.00) (30,940.00) 5, , , , , , ,252, (39,796.98) (8,900.00) 47, (15,301.28) (6,089.00) (1,165.18) (129,048.26) (247,016.19) (15,891.58) (18,239.85) 4,206, , ,675, , , ,317, , ,956, , , , , , , , , ,553, ,481, , , , , ,145, ,963, , , , , ,176, ,053, , , , , , , , , , , , , , , ,827, ,744, , ,267, ,967, ,887, ,026, , , , , ,273, , , , , , , , , , , , , , ,118, , , , ,029, ,101, , , , , ,433, ,570, , , , , , , , , , ~ , , , , ,002, ,246, , ,400, , , ,732, , , ~ c.n
255 Schedule S-110- Schedule of Changes in Investment in Plant- Equipment For the Year Ended August 31, 2013 N... ()) CARRYING VALUE DEPRECIATION Description Balance 9/1/12 Additions Disposals Adjustments Transfers Balance 8/31/13 Depreciation Beginning Balance Depreciation Expense Depreciation Disposals Total Total Depreciation Depreciation Accumulated Adjustments Transfers Depreciation Net Basis ROTORS AND HEADS SCAN SYSTEMS SCINTILLATION SYSTEMS ULTRASOUND EQUIPMENT SPECTROFLUOROMETER SPECTROMETER SPECTROPHOTOMETER STEREOTAXIC INSTRUMENT AND ACCESSORIES STIMULATOR TABLES: DISSECTING, OPERATING, BALANCING TANKS, CONTAINERS, CHAMBERS, ALL TYPES WATER PURIFICATIONS X-RAY EQUIPMENT MISC. LAB AND SCIENTIFIC EQUIPMENT PATIENT MONITORING SYSTEMS BREATHING APPARATUS, RESPIRATOR DEFIBRILLATOR EKG/ECG/EEG APPARATUS CLINICAL DIAGNOSTIC INSTRUMENTS TABLE, EXAM WHEELCHAIRS MISC SURGICAL INSTRUMENTS PATIENT CARE MISC. ROBOTICS DNA SEQUENCER & ACCESSORIES PBX, KSU, PHONE SYSTEM/VOICE MAIL AUTOMATIC CALL DISTRIBUTORS OTHER TELECOMMUNICATION EQUIPMENT TRAILERS OTHER VEHICLES- GRADER, A TV'S TOTAL EQUIPMENT 369, ,586, , , , ,217, ,210, S3, , , ,776, , ,270, ,998, , , , , , , , , , , , ,978, , , , ,760, ,246, , S,6S , , ,844, , , , , , ,631, , ,937.SO 1,231, (13,000.00) 4,056, (25,213.00) (61,921.26) (312,222.38) (53,695.90) (14,882.17) (482,109.61) (33,702.00) 6, (227,205.71) (6,365,914.78) (4,057,505.51) (12,606.00) (18,423.54) (5,762.2S) (35,837.00) 34, , ,927, , , S, ,687, ,250, , , , ,642, , ,338, ,241, , , , , , , , , , , , ,204, , ,283.2S 216, ,3S6,1S ,92S.46 24, , ,667, ,296,S18.SO 19,1S , , ,061, , , , ,462, ,265.2S 3, , ,7S , ,796, , , , ,349, , ,208, ,526, , , , , , , , , , , S9, ,917, , , , , , S8, , , , ,97S , , (11,452.38) (25,213.00) (93,443.27) (53,695.90) (1,187.67) (420,733.62) (29,362.00) (218,672.07) (5,S80,41S.20) (3,991.90) (18,423.54) (S,762.25) (3S,837.00) 65, , ,417, , , , ,037, ,367,087.8S 22, , , ,525, , ,296, (33,584.45) 140,186, , , , , , , ,S , , , , ,116,S , , ,1S8.47 4,510, , , , ,650, , , ,S , ,117,057.S4 275, ,041, ,054, , , , , , , , , ,088, , , , S4, , , , (47,821.00) 8, (90,000.00) 5,161, ,294, , (36,73S.12) (60,000.03) 3,621, ,540, ,696, (36,985,8_07.79) 642, ,852, ,452, ,914, ,682, {31,693,104.82) 116, ,955, ,976, ,476, , Vehicles and Aircraft PASSENGER CARS HEAVY TRUCKS: LBS AND OVER SMALL BUSES' UP TO 1S PASSENGER MOTORCYCLES VEHICLE COMPONENTS VEHICLE COMPONENTS/LIFE 10 YRS UTILITY VEHICLES VANS LIGHT TRUCKS: UNDER 8600 LBS. GViN TRUCKS AND TRUCK-MOUNTED EQUIPMENT SELF-PROPELLED ROADWAY EQUIPMENT TOWED ROADWAY EQUIPMENT LIGHT/MEDIUM TRUCK5;B LBS. GVW MEDIUM TRUCKS:15D LBS. GVW MINI VAN5-AEROSTAR/VOYAGER/VILLAGER, ETC BUSES' PASSENGER BOATS:20 FT AND LONGER BOATS:SHORTER THAN 20FT BOAT:ACCESSORIES, MOTORS MARINE EQUIPMENT 873, ,305, , , , , ,722, ,182, ,440, , , , , , , , , , , ,042, , , , , ,552, , , ,SOO.OO 3,065, (29,583.00) (94,040.70) (5,545.00) (41,858.00) (218,264.67) (75,178.63) (142,908.00) (20,100.00) (1,683,856.14) (42,176.17) 900, ,317, , , , , ,971, ,516, ,395, , , , , , , , , , , ,381, , ,682, , , , , ,360, ,796, ,995, , , , ,1S ,S , , , , ,189, , , , , , , , , , , , S4, , , , , ,363, (29,583.00) (94,040.70) (4,251.93) (41,858.00) (218,254.57) (72,803.31) (142,908.00) (20,100.00) (530,372.00) 680, , 728, , , , , ,438, ,095, ,086, , , , , , , , , , , ,022, , , ,688.S3 6, , ,420, , , ,04S.34 27, , , , , , , ,358,966.47
256 Schedule S-110- Schedule of Changes in Investment in Plant- Equipment For the Year Ended August 31, 2013 CARRYING VALUE DEPRECIATION Description Balance 9/1/12 Additions Disposals Adjustments Transfers Balance 8/31/13 Total Total Depreciation Depreciation Depreciation Depreciation Depreciation Accumulated Beginning Balance Expense Disposals Adjustments Transfers Depreciation Net Basis OTHER BOATS, CANOES, ROWBOATS AIRCRAFT: JET HELICOPTERS OTHER AIRCRAFT TOTAL VEHICLES AND AIRCRAFT Other Assets LEASEHOLD IMPROVEMENTS LIBRARY- BOOKS WORKS OF ART-HISTRCL TRSRS-INEXHAUSTIBLE LIVESTOCK/OTHER ANIMALS TOTAL OTHER ASSETS TOTALS Educational & General Designated Funds Restricted Expendable Auxiliary Enterprises Summary of Additions Unexpended Plant Funds Gifts Government Furnished Equipment Found Completed Construction in Progress Trade-Ins Other Adjustments 340,S53,96 340, , , , , ,52S.OO 15, , S,S2S.OO 54, , , , , , , , , '- : - 21, ,105, ,194, (2,311,335.14) (42,176.17) 26,946, ~,1~~-17 _4,709, (1,1i4,181.61) ~?,~7~,5~-II_~ Ll 6, ,620, ,620, , ,0S9.41 1,0S4, , ,311, ,962,724.4S 3,622, ,896, ,479,6S ,651, ,130,97S.S8 64,765, ,712, ,761, (4S3,676.00) 252,019, S2,019, , l2,soo.oo 14, , , , ,666, ,723, (453,676.00) 3,622,n ,559J ,387, ,815, ,202, ,357, ,114,017, ,615, (39,7so,8_!_8.93l 6o_o,z~ 5,11_75, ,219,958, ,426, ,207, (32,847,286.43) 116, ,955, ,8S8,44Z.s9 528,100, Equipment Library Books & Museum&Art Vehicles, Boats, Other Non- &Aircraft Depreciable Depreciable Total Additions 2,882, , ,350, , ,670, ,576, , ,655, ,754, ,818, ,90S , , ,399, , , , ,432, , ,809, ,02S, ,094, ,86S, S8,985, ,299, , ,304, , (198,727.10) (140,135.54) 2,970, ,369, ,339, , , , , ,797, ,645, ,696, ,194, ,962, ,761, ,615, ~ "'
257 Schedule S-11e- Schedule of Changes in Investment in Plant- Construction in Progress For the Year Ended August 31, ,. N CX> Project Name ART- EVAL-UPGRADE BLDG VENTILATION PROJ ART BUILDING Art Building And Museum Total Carrying Value , , Additions (8-8 Recap) 102, ,39 639, Carrying Value Adjustments Adjusted Carrying Value , , Deductions Additions to Existing Facilities and Equipment and Carrying Value New Buildings Buildings Infrastructure Fabrication , , ATT- CONSOLIDATE OFFICES At& T Executive Educ & Conf Center Total 438, , , , , AFP- DESIGN & CONSTRUCT TENT Athletic Fields Pavilion Total 1,220, ,220, ,220, ,220, BTL- BLDG AUTOMATION SYS UPGRADE PROJ BATTLE HALL COMPLEX PROJ BATTLE HALL COMPLEX Battle Hall Total 34, , , , (34,000.00) , , ,6n.84 50, n, JES- 2ND FLOOR CAFETERIA PHASE 4 JES- 2ND FLR CAFETERIA RENOVATION JES- ClASSROOM RENOVATION JES- HVAC RENO JES -SUITE A332A RENOVATION JES - SUITE A332A RENOVATION JES - SUITE A332A RENOVATION PROJ JESTER EAST LOBBY RENO Beauford H. Jester Center Total 107, , , , ,526, ,321, , , , , , ,057, ,235, ,634, ,321, , , , , , ,147, ,634, ,321, , , , , , ,127, , PROJ BELO CTR FOR NEW MEDIA PROJ BELO CTR FOR NEW MEDIA PROJ BELO CTR FOR NEW MEDIA PROJ 102~041 BELO CTR FOR NEW MEDIA PROJ BELO CTR FOR NEW MEDIA PROJ BELO CTR FOR NEW MEDIA PROJ BELO CTR FOR NEW MEDIA PROJ BELO CTR FOR NEW MEDIA PROJ BELO CTR FOR NEW MEDIA PROJ BELO CTR FOR NEW MEDIA Belo Center For New Media Total 495, , , (4,555,019.72) 1 (4,555,019.72) 4,555, ,648, ,648, (6,648,945,62) 1 116, , (116,251.72) 1 1,506, ,011, (1,506,983.43) 1 7,229, g;g:.::::~ (4,555,019.n) 6,648, , ,506, ,229, ) ,.,_:-;_:-;.-=-: - IU,1:141, (4,555,019.72) 6,648, , ,506, ,229, ,947, PROJ BIOMEDICAL ENG BLDG PROJ BIOMEDICAL ENG BLDG PROJ BIOMEDICAL ENG BLDG Biomedical Engineering Building Total 55, (65,912.92) 167, , ,312, , , ,916, ,368, , ,073, ,368, , ,073,857,63 BRK- HVAC & BLDG RENO PHASE 8 Brackenridge Apartments Total , , , BFL- NEW GREENHOUSE & LAB RENOV Brackenridge Field Laboratory Total 80, , , , CAL- AHU RENOVATION CAL- AHU RENOVATION PH 2 Calhoun Hall Total 3, , , , , , , , CAM- ADA RAMP FROM GOL TO WMB CAM- BARRICK LAB RENOVATIONS CAM- CAMPUS WAYFINDING CAM~ FIBER & ELEC ESPN UPGRADES CAM -INSTALL ROOF SAFETY ELEMENTS CAM~ MORAN & OCHMAN RENOVATIONS CAM- REUSE WATER SYS CONSTRUCTION PROJ SPEEDWAY MALL NORTH OF PROJ INDOOR TENNIS FACILITY PROJ INDOOR TENNIS FACILITY PROJ FIRE&LFE SFTY PRJ FY08 PROJ HIGH PRIORITY FRE FY09 PROJ FY10 HIGH PRIORITY F&L PROJ FY10 FACULTY STARS REN PROJ FY11 HIGH PRIORITY F&L PROJ LERR- R&R FY 10/11 PROJ HPCF EXPANSION PROJ FY11 FIRE SAFETY & ITS PROJ FY12 HIGH PRIORITY F&L 9, , , , ,239, ,036, , , , ,067, , , , , (502,723.19) (293,863.24) 17, , ,462, , , , , , , ,241, , , (7,498,671.91) 3 7,498, , , , , , , ,239, ,498, , , ,021, , , ,393, ,241, , , ,498, , , , , , , ,239, , , , , , , , , ,393, ,241, , , ,431.31
258 Schedule S-11e- Schedule of Changes in Investment in Plant- Construction in Progress For the Year Ended August 31, 2013 Carr in Value Deductions Carrying Value Project Name PROJ FY11 FACSTARSRENOV 187, PROJ FY13 HIGH PRIORITY F&L PROJ FY 12 LERR- FIRE/LIFE 69, PROJ FY12 FACULTY STARS REN PROJ LERR FY R&R SZB- ESCALATOR IMPROVEMENTS Campus Total 10,112, Additions (S-8 Recap) 253, , ,883, , , ,178, Adjustments Adjusted Carrying Additions to Existing Facilities and Equipment and carrying Value Value New Buildings Buildings Infrastructure Fabrication , , , , ,952, ,952, , , , , , ,291, ,498, ,925, ,866, CPE- GAS DETECTION SYSTEM 494, CPE - GAS DETECTION SYSTEM 82, CPE - GAS DETECTION SYSTEM CPE- GAS MONITORING SYSTEM STUDY CPE- GAS MONITORING SYSTEM STUDY CPE- MISC. CLASSROOM IMPROVEMENTS CPE - REMODEL CEMENT LAB CPE- REMODEL CEMENT LAB CPE - REMODEL CEMENT LAB CPE- REPLACE FUME HOOD EXHAUST SYS 51, CPE- RE-ROUTE MAIN WATER LINE CPE- RE-ROUTE MAIN WATER LINE CPE- STUDENT LOUNGE RENOVATION 48, CPE- STUDENT LOUNGE RENOVATION Chemical And Petroleum Engineering Total 677, , , , , , , , , , , , , , ,836, , , , , , , , , , , , , , , , , , , , , , , , , , , ,513, ,451, , PROJ CLARK FIELD RENOVATION PROJ CLARK FIELD RENOVATION Clark Field Total 408, ( ) 408, , ( ) ( ) CBA- RE-ROOF AND RESTORE SKYLIGHT College of Business Administration Total ,698, ,698, ,698, CRB- DATA CENTER BUILD OUT Computational Resource Building Total 122, ,348, ,470, ,470, PROJ DKR SOUTH END ZONE 339, PROJ DKR-TMS-ATHLETICS OFFC PROJ DKR-TMS-ATHLETICS OFFC PROJ DKR-TMS-ATHLETICS OFFC Darrell K Royal Tx Memorial Stadium Total 339, PROJ A INFRASTRC/SITE PREP Dell Medical School Complex Total DFA- AUTO FIRE SPRINKLER SYS RETRO DFA- BAS UPGRADE 1, DFA- FIRE ALARM SYSTEM RETROFIT E. William Doty Fine Arts Building Total 1, EPS- RENOVATE 1ST/2ND/4TH FLOORS 1, EPS- RENOVATE FLOORS 1, 2 & E.P. Schoch Building Total 1, PROJ ITS-NOC & VOICE EERC PROJ ENG EDU RESEARCH CTR 200, PROJ ENG EDU RESEARCH CTR 3,133, PROJ ENG EDU RESEARCH CTR 279, PROJ ENG EDU RESEARCH CTR 9,197, PROJ ENG EDU RESEARCH CTR PROJ ENG EDU RESEARCH CTR Engineering Education & Research Center Total 12,811, ETC- BEN-YAKAR LAB RENOVATION 182, ETC- BEN-YAKAR LAB RENOVATION 11, ETC- LAB RENOV FOR DR. WANG ETC- LAB RENOVATION 138, ETC- LAB RENOVATION ETC- LAB RENOVATIONS FOR DR.YU ETC- LAB RENOVATIONS FOR DR.YU ETC- MISC. CLASSROOM IMPROVEMENTS Engineering Teaching Center Total 332, , ,903, ,003, (3,903,867.77) ,382, , , (1,553.17) , (1,622.63) (76.59) (1,699.22) 3, ,868, ,713, (9, 197,886.05) 241, ,083, , , , , , , , , , , ,903, ,903, ,099, ,099, ,722, ,326, ,903, , , , , , , , , , , , ,002, ,002, ,992, ,992, , , ,894, ,894, , , , , , , , , , , '-' 37, , "" <0 3, , , , ,276.91
259 Schedule S-11e- Schedule of Changes in Investment in Plant- Construction in Progress For the Year Ended August 31,2013 N 01 a Carrying Value Deductions Project Name ENS- RELOCATE MICROSCOPE Engineering-Science Bldg. Total Carrying Value , Additions (S-8 Recap) (187,830.74) (187,830.74) Adjustments Adjusted Carrying Value New Buildings Additions to Existing Buildings Facilities and Infrastructure Equipment and Fabrication Carrying Value FABRICATION AND EQUIPMENT 67,873, ,435, (1,231,590.07) 5 FABRICATION AND EQUIPMENT Fabrication Of Equipment Total -----=/?-1,9:!! 1 ~' ~.4~7~ 6 5 ~!-:_;~o 17,435, /~,;~~:~~~~~~ , ,332, ,745, ,077, ,332, ,745, FC1- FACILITIES BLDG IMPROVEMENTS Facilities Complex Bldg. 1 Total , (6,886.66) (6,886.66) FC3- MAINTENANCE, ENERGY OPERATION FC3- PHOTOVOLTAIC PROJECTO Facilities Complex Bldg. 3 Total 45, , , , ,605, , ,605, ERG- SEAT!RISER REPLACEMENT Frank C Erwin Special Events Center Total 1,372, ,372, , ,228, ,228, PROJ DELL COMPUTER SCIENCE PROJ DELL COMPUTER SCIENCE PROJ DELL COMPUTER SCIENCE PROJ DELL COMPUTER SCIENCE PROJ DELL COMPUTER SCIENCE PROJ DELL COMPUTER SCIENCE PROJ DELL COMPUTER SCIENCE PROJ DELL COMPUTER SCIENCE Gates Dell Complex Total 22,141, ,630, ,000, ,772, , , (197,363.86) 2 262, ,287, (262,632.41) 2 351, (13,561.85) (351,022.60) 2 1,210, , ,285, , ,654, , ,635, ,210, , ~ IVI,OOI,~ 9, ( ) 2 0 LO'+,I 25,108, n nn 197, ,285, , ,654, , ,635, ,210, ,859, ,021, PROJ GEOGRAPHY BUILDING PROJ GEOGRAPHY BUILDING Geography Building Total , ,535, (416,804.23) 4,118, ,535, ,535, ,535, ,535, SZB- UPGRADE BLDG AUTOMATION SYS George I. Sanchez Building Total GOL- FIRE ALARM & SPRINKLER UPGRAD Goldsmith Hall Total , (239.20) (239.20) , , GSB- BAS UPGRADE GSB- CARPENTER CTR MINOR REMODEL GSB- RENOVATION OF LAB PROJ GRAD BUSINESS SCHOOL Graduate School Of Business Bldg. Total 41, , , , I 41,268.69) 262, ,938, , , , ,292, , , , ,979, GRE- CONVERT 3.108C TO TRAINING RM GRE- NIKE STORE FLOORS 1 & 2 GRE- NIKE STORE FLOORS 1 & 2 Gregory Gymnasium Total 116, , , , , , , , , , , PRC-A18-ADDBAY PRC- ARL- NEW STORAGE BUILDING PRC- BE1 -ADA ACCESS COMPLIANCE PRC- BEG- BUILD OFFICES IN PRC- BEG- BUILD OFFICES IN PRC- BEG- RENOVATE RECEPTION DESK PRC- EME- HVAC MODIFICATIONS PRC- EME- LAB RENOVATIONS PRC- MER -REPLACE JOHNSON CTRL SY PRC- NEL- IMPROVE EGRESS!INGRESS PRC- NEL- IMPROVE EGRESSfiNGRESS PRC- ROC -1ST FL RENOVATIONS J.J. Pickle Research Campus Total PAT- 5TH FLR RENOVATION J.T. Patterson Labs.Bidg. Total 145, , , , , , , , , , , , , , , ,252, ,299, (8,763.03) (8,763.03) 396, , , , , , , , , ,799, , , , , , , , ,252, , ,763, , PROJ BLANTON MUSEUM OF ART JackS. Blanton Museum of Art Total
260 Schedule S-11e- Schedule of Changes in Investment in Plant- Construction in Progress For the Year Ended August 31,2013 Carr~ins Value Deductions Carrying Value Project Name JGB- FIRE SPRINKLER SYS RETROFIT 1, JGB- FISSION TRACK LAB RENOVATION JGB- FISSION TRACK LAB RENOVATION PROJ HOLLAND STUDENT CENTER Jackson Geological Sciences Bldg. Total 1, Additions (S-8 Recap) , , , Adjustments Adjusted Carrying Additions to Existing Facilities and Equipment and carrying Value Value New Buildin~s Buildings Infrastructure Fabrication , , , , , , , , , CMA- UPGRADE GROUNDING SYSTEM Jesse H. Jones Communication Center (Bldg. f\} Total 37, ( (37,031.48) JON- AV INSTALLATIONS 10, JON- RENOVATE 1ST FL RESTROOMS Jesse H. Jones Hall Total 10, (10,294.14) (3,640.96) , , JCD- COMPLETE FIRE OEP CONNEC PROJ JCD- REPLACE 5W & 7W AIR HANDLER PROJ JESTER EAST RENOVATION PROJ JESTER WEST MAINT Jester Dormitory Total 124, , ,478, ,453, , , , , ,478, ,478, ,453, , ,509, GHM- ADA RESTROOM & ELEVATOR TOWER GHM- ADA RESTROOM & ELEVATOR TOWER John Nance Garner House and Museum Total 526, , , , , , BEL- LIBERAL ARTS RENO DR BEEVERS BEL-RENOVATIONS TO RM 528 BEL- STUDENT RECOVERY CENTER RENO BEL- KINESIOLOGY RENOVATIONS L. Theo Bellmont Hall Total 54, , , , , , , , , , , , , PROJ TEXAS SWIMMING CENTER 109, TSC- CATWALK PANEL REPLACEMENT Lee & Joe Jamail Texas Swimming Center Total 109, , , , , , , , PROJ LIBERAL ARTS BUILDING PROJ LIBERAL ARTS BUILDING 2,000, PROJ LIBERAL ARTS BUILDING PROJ LIBERAL ARTS BUILDING 61,362, PROJ LIBERAL ARTS BUILDING PROJ LIBERAL ARTS BUILDING 489, PROJ LIBERAL ARTS BUILDING PROJ LIBERAL ARTS BUILDING Liberal Arts Building Total 74,350, LTD- REPLACE ROOF SUMMER 2012 Littlefield Dormitory Total MAl - DESIGN SVCS TO RENO 27TH FL MAl- EMERGENCY GENERATOR 86, MAl- FIRE & LIFE SAFETY COMPLIANCE 3, MAl - HVAC BAS UPGRADES MAl - REMODEL OFFICES RMS 1 AND 16 MAl- RENOVATE INFORMATION KIOSK MAl- RENOVATE INFORMATION KIOSK MAl- RENOVATE UNDERGRAD STUDY OFFC Main Building Total 89, PROJ MSI ESTUARINE RESEARCH 894, PROJ MSI ESTUARINE RESEARCH (587,304.31) PROJ MSI ESTUARINE RESEARCH (301,088.82) PROJ MSI ESTUARINE RESEARCH Marine Science Institute- Port Aransas, Tx Total 537, GEA- HVAC & ELECTRICAL RENO 1,747, GEA- RENO FOR MICHELLE FORMAN 65, GEA- RESOLVE HVAC OPERATIONS Mary E. Gearing Hall Total 1,832, , (40,000.00) 2 1,237, , (1,237,218.58) 2 74, ,216, (74,105.27) 2 291, { }2 8,556, , , , , , , , , , ,804, (495,545.43) ( ) 1,098, , , (18, ,161, , , ,960, ,960, ,237, ,237, ,623, ,623, , , ,631 ' ,631 ' , , ,906, ,264, ,642, , , , , , , , , , , , , , , , , , , , ,215, ,215, ,216, ,216, (796,634.25) (796,634.25) 1,636, ,636, ,657, ,657, N 336, , ~ 2,994, ,994,104.97
261 Schedule S-11e- Schedule of Changes in Investment in Plant- Construction in Progress For the Year Ended August31, 2013 N en N Carr in Value Deductions Carrying Value Project Name MCD- 82 DOME & 107 DOME EGRESS 48, MCD - HET LCOGT TELESCOPE PARK 212, MCD - M67 - REMODEL HET SUPPORT BOG 49, MCD- REMODEL HET SUPPORT BUILDING MCD - REMODEL HET SUPPORT BUILDING 72, MCD- WASTE WATER RESTORATION 16, PROJ MCD FLS & INFR UPGRADE Mcdonald Observatory- Ft. Davis, Tx Total 561, Additions (S-8 Recap} 40, (212,588.25) 31, , , (16,665.95) ,987, Adjustments Adjusted Carrying Additions to Existing Value New Buildings Buildings 89, , , , ,549, Facilities and Infrastructure Equipment and Fabrication Carrying Value , , , , ,549, MBB- FINKELSTEIN LAB RENOVATIONS MBB- FINKELSTEIN LAB RENOVATIONS MBB- LAB/OFFICE RENO- ELLINGTON MBB - NEW FIRE ALARM SYSTEM Moffett Molecular Biology Building Total , , , , , , , , , , , , , MNC- DESIGN/REMOD OFFICE SUITE PH1 MNC - UPDATE CENTER Moncrief-Neuhaus Athletic Center Total 224, , , , , , MHO- HVAC RENOVATION Moore-Hill Dormitory Total , , , NMS- COOLING FOR GROWTH CHAMBERS 5, NMS- MATOUSCHE LAB RENOVATION Neural And Molecular Science Bldg. Total 5, , , , , , , NHB- IMAGING CORE PROJ NORMAN HACKERMAN BLDG PROJ NORMAN HACKERMAN BLDG PROJ NORMAN HACKERMAN BLDG Norman Hackerman Building Total 16, ,245, , ,126, , , ,245, ,245, , , ,126, ,126, PROJ OUTDOOR POOL 109, PROJ OUTDOOR POOL Outdoor Pool Total 174, , , , , PAR- HVAC AND ELEC RENOVATION Parlin Hall Total , , , PAC- BAS UPGRADE PAC- FIRE ALARM & SMOKE MGT PAC- FIRE ALARM & SMOKE MGT PAC INFRASTRUCTURE UPGRADES Performing Arts Center Total 1, , , , , , , , , , , , , PCL- FIRE SPRINKLER UPGRADES PCL- FIRE SPRINKLER UPGRADES PCL- HVAC BAS UPGRADE Perry-Castaneda Library Total 7, , , , , , , , , POB -ICES STRATEGIC PLAN & IMPLEM Peter Odonnell Jr. Building Total , , , FAC- ENERGY INSTITUTE INCUBATOR FAC- ENERGY INSTITUTE INCUBATOR 3, FAC- 10 CENTER REMODEL FAC- RM 212 RENOVATION 65, FAC- ROOM 212 RENOVATION 84, PROJ FLAWN ACADEMIC CENTER PROJ FLAWN ACADEMIC CENTER Peter T. Aawn Academic Center Total 153, , , , , (1,986,891.66) , , , , , , , , , , (1,986,891.66) , , (1,986,891.66) , PPB- FIRE SPRINKLER SYSTEM Printing and Press Building Total , , , HRH - ELECTRICAL DIST UPGRADE Rainey Hall Total 165, , , , PROJ REC SPORTS CENTER Recreational Sports Center Total 261, ,193, ,455, ,455,405.52
262 Schedule S-11e- Schedule of Changes in Investment in Plant- Construction in Progress For the Year Ended August 31,2013 Carr in Value Deductions Carrying Value Project Name Additions (S-8 Recap) Adjustments Adjusted Carrying Additions to Existing Facilities and Equipment and carrying Value Value New Buildinis Buildinss Infrastructure Fabrication MFH- SOCCER RENOVATIONS Richard Mithoff Track and Soccor Fieldhouse Total , , , WEL WING BAS UPGRADE 6, WEL- CHEMISTRY LIBRARY RENOV WEL- LAB RENOVATIONS WEL- LAB RENOVATIONS WEL- PAR FOR ROSE LAB RENOVATION WEL- RENOVATION OF RM , WEL- WEST WING BAS UPGRADE Robert A. Welch Hall Total 417, (6,088.54) 108, , , , , , , , , , , , , , , , ,109, ,109, RLM- ADNTAS RESTROOMS RENOVATIONS RLM -INSTALL OF RECOVERY SYSTEM RLM- PAR LAB RENOVATION RLM- PAR LAB RENOVATION RLM- UPGRADE EMERGENCY POWER Robert Lee Moore Hall Total 255, , , , , , , , , , , , , , , , , SSW- ABATE ASBESTOS UNDER DAYCARE 5, SSW- RENOVATE STUDENT LEARNING CTR SSW- RENOVATE STUDENT LEARNING CTR School Of Social Work Building Total 5, , , , , , , , , , SER- REMOVE AND REPLACE ROOF SER- RM 319D AIC UPGRADE Service Building Total 152, , , , , , PROJ SRH UNIT2 RENOVATION PROJ SRH UNIT 2 RENOVATION SRH- UPGRADEIREPLACE HVAC BAS Sid Richardson Hall Total , , {842.29) 303, , , , , , , PROJ STUDENT ACTIVITY CTR Student Activity Center Total , , so1,o82.n SSB- UPGRADE FIRE ALARM SYSTEM Student Services Building Total , , , SUT ~ LASER CUTTER RELOCATION 87, SUT - LASER CUTTERS EXHAUST SYSTEM 224, SUT- RENEWAL OF HVAC SYSTEM Sutton Hall Total 968, , , , , , , , ,406, ,034, , PAl~ RENOVATE FOR INTERVIEW ROOMS T.S. Painter Hall Total (400.00) (400.00) W19- CORRECT EXISTING GRADING W19- CORRECT EXISTING GRADING The Meadows Foundation Education Center Total 50, , , , , , TNH- ADA 3RD FL RESTROOM RENO TNH- ADA RESTROOM RENOVATION TNH- HVAC & ELECTRICAL RENEWAL PH1 TNH- PROVIDE SPRINKLER PROTECTION TNH- RENOVATE SHEFFIELD RM Townes Hall Total 2, , , , , , , , , , , , PROJ TX UNION RENOVATION PROJ TX UNION RENOVATION Union Building Total 378, , , , , , USX ~SITE PREPARATION & MISC WORK Univ. Bern. School Admin. Bldg. II Total 5, PROJ UT ADMIN BLDG RENOV 11, PROJ UT ADMINISTRATION BLDG PROJ UT ADMINISTRATION BLDG PROJ UT ADMINISTRATION BLDG Ut Administration Building Total 11, ( ) (5,165.70) (11,587.68) 3,330, , } 162, N 01 w 3,330, ,330, , , } 13, } 174, ,342.37
263 Schedule S-11e- Schedule of Changes in Investment in Plant- Construction in Progress For the Year Ended August 31, \) ~ Carrying Value Deductions Project Name Carrying Value Additions (S-8 Recap) Adjustments Adjusted Carrying Value New Buildings Additions to Existing Buildings Facilities and Infrastructure Equipment and Fabrication Carrying Value WRW- DR. LU LAB RENOVATION RM 1038 WRW- PAR FOR LU- RENOV RM 103B W.R. Woolrich Labs. Total 7, i"i , , , , , , WAG- PROVIDE SPRLKR&FIRE ALARM SYS WAG- RENEWAL OF HVAC SYSTEM Waggener Hall Total 672, , , , , , , , , WMB -BLDG AUTOMATION SYS UPGRADE West Mall Office Bldg. Total , , , , PROJ WHITAKER FIELDS& TENNIS Whitaker Fields Total , , , , PROJ CHILDREN'S GARDEN Wildflower Ctr Children Discovery Total , , , , , WCH- BLDG AUTOMATION SYS UPGRADE Will C. Hogg Building Total , , Total Construction In Progress {B-11) 260,559, (5, ) 410,273, Footnotes: 1 Prior year construction type adjustment from New Buildings to Existing Buildings 2 Prior year construction type adjustment from New Buildings to Facilities/Improvements 3 Prior year construction type adjustment from Facilitiesflmprovements to New Buildings 4 Prior year construction type adjustment fromexisting Buildings to Facilities/Improvements 5 Adjustments to equipment fabrication (5,339,851.57) ( ) Reconciliation to S...S Recap: S-11e Additions Fabrication of equipment in restricted funds not on S-8 Recap Expense for buildings in restricted funds not on S...S Recap S-11e Additions Adjusted S-8 Recap Buildings S-8 Recap Improvements other than Buildings S-8 Recap Total Additions 155,054, ,435, , ,346, ,844, ,502, ,346,846.27
264 Schedule S-11 e- Schedule of Changes in Investment in Plant- Construction in Progress For the Year Ended August 31, 2013 Carr~in~ Value Deductions Carrying Value Project Name Additions (S-8 Recap) Adjustments Adjusted Carrying Additions to Existing Value New Buildings Buildings Facilities and Infrastructure Equipment and Fabrication Carrying Value REQAPITUlf> TIQN BY IYPE QE QQ~SIB!.!QIIQ~ TOTAL NEW BUILDINGS 164,826, ,268, (7, 112,229.44) 208,983, ,622, ,360, TOTAL ADDITIONS TO EXISTING BUILDINGS 15,140, ,032, ,043, ,216, ,136, ,079, TOTAL IMPROVEMENTS OTHER THAN BUILDINGS 7,432, ,115, , ,617, ,788, ,829, TOTAL INFRASTRUCTURE 1,177, ,202, ,379, ,379, TOTAL FABRICATION OF EQUIPMENT 71,982, ,435, (5,339,851.57) 84,077, ,332, ,745, TOTAL AS SHOWN ABOVE ,054, (5,339,851.57) 410,273, , , ,788, , , BE~AEII!!I8IIQhl HY!YEE QE Ellh~QI~G SQI!BCE FROM LEGISLATIVE ENACTMENTS FROM PERMANENT UNIVERSITY FUND BONDS/NOTEE 24,929, ,268, ,198, ,285, ,548, , ,167, FROM AVAILABLE UNIVERSITY FUND 3.642, ,557, ,200, ,960, ,269, , ,931, FROM INTEREST EARNED ON CONSTRUCTION FUND~ 431, ,566, ,997, ,506, ,490, FROM REVENUE BONDS/NOTES ,632, ,334, ,186, ,403, ,466, FROM PRIVATE GIFTS 51,254, ,828, ,083, ,765, ,427, , ,465, FROM FEDERAL GRANTS 68,672, ,707, (1,231,590.07) 86,148, ,071, ,332, ,745, FROM OTHER SOURCES- OTHER 33,667, ,907, (4,108,261.50) 64,466, ,333, ,549, ,501, ,082, FROM OTHER SOURCES- AUXILIARY ENTERPRISES 2,259, ,585, ,844, ,577, ,220, ,046, TOTAL AS SHOWN ABOVE 260, ,054, (5,339,851.57) ,622, , , 788, ,332, ,394, ~ 01 01
265 The University oft exas at Austin Schedule S-11f- Schedule of Changes in Investment in Plant- Infrastructure /Infrastructure Improvements For the Year Ended August31, 2013 N 01 (j) MAIN CAMPUS i);;~ripu;,;=.,~~"~" Carrying Value bia p~~ai;ry ~~~~f~~~m cw~ f Tmmw ; MODIFICAlYoN AND'EXPANSJON'OF LtilUT7SYSTEM '!:,~:~~~:~l~~~t~~fi~v~~~~at~-~?}~~~ ~ RTAT!oN!NFRASrRUCTU'R~~~ ~~~~~~~1~~~;~r~:j~;}~~~:~~: MOoiF!C~~~~~f!?N~~N~!~~,,,.,}:t~N'" t STEAM AND ELECTRICAL DISTRIBUTION SYSTEM f'teleph"ont:tswftchexpan"sion"""""..,._,,.,., ' '"""' "~"', fthermalenergytanicchfiteihvafeifpi'pes., :f'.:'e'~'c"/\mpds DRIVE " "' <m.n.w.,--.,~ ~"-"'"' v ~ '- '.o.-cn~~~ J.J. PICKLE RESEARCH CAMPUS f'""" '" """" """~=" """"~---w o;;~ipti~ ;v == ""' : ElecTRTCAL6JsTRIBtJTIO'N'SvsTI f'~l~~~~~~~tt~~~t~~~~t~~~ E DEVELO"PMENT"A'NQ'Uf(CitY 0JStRlsliri6N. t WATEFfDiSTRiBuTJ6N"SYSTEM": REPLACEC:'OOER core OF u(fsys..,"""''"m" ~.~_:.J: P!~. LE"R~~E!{R?~:9~~.~~S iot~l~:n..,n,,.~=:::=w.. :~~-:~"~wm.vwn ~!!~.~~~.Y}~!i!~i'!!"~~~~.~!,~.Im.M~O~~ ~mmmm~~m '"'--~nption L~Y~Q~:iE~~~-~~Eff?!~:~ w ;wo,'" w ""'"::se~~y~~-3.:~,~, '~' ' Notes: Beginning Balance, as previously reported Add: Additions (S-11e) Book Value of Plant, Beginning Accumulated Depreciation Balance, 9-01w 12 Add: Current Year Depreciation Expense Adjustments Accumulated Depredation, ,347, ,347, ,767, ,227, (1,688.79) 40,993, Net Book Value of Capital Assets, 8-31w 13 15,353, Footnotes: Adjusbnents to Depreciation: True up accumulated depreciation
266 Schedule S~11G ~Schedule of Changes in Investment in Plant: Intangible Assets For the Year Ended August 31, 2013 Description CARRYING VALUE AMORTIZATION Non-Amortizable Intangible Assets EASEMENTS- RIGHT OF WAY PERM RADIO STATION- BROADCAST FREQUENCY OTHER LAND USE RIGHTS TERM TOTAL NON-AMORTIZABLE INTANGIBLE ASSETS Balance Additions 9/1/12 3,209,4S5.00 6,001, ,209, ,001, Disposals Adjustments Transfers Balance Accumulated Amortization 8/31/13 Amortization Expense 9/1/12 3,209, ,001, ,211, Amortization Disposals Amortization Transfers Accumulated Amortization, 8/31/13 Net Basis 3,209, ,001, ,211, Amortizable Intangible Assets PURCHASED SOFTWARE INTERNALLY DEVELOPED SOFTWARE CUSTOMIZED SOFTWARE (ISAS) TOTAL AMORTIZABLE INTANGIBLE ASSETS 224,1S5, ,860, ,6S7, , ,S61, ,860, (13,755,382.82) (21,445,843.67) (985,000.00) 1749,672.00) (14,50S,054.82) (22,430, (646,068.60) 197,167, ,304, ,119, ,672, ,04S, , , (646,068.60) 20S,840,0S4.3S 129,100, ,191, (13,755,382.82) (196,683.77) 1749, (14,50S,OS4.82) (196, ,471,5D1.24 8,118, ,S89, ,696, S4,009.0S 15,250, TOTAL INTANGIBLE ASSETS 237,771, ,862, (14,50S,054.82) (22,430,843.67) (646,068.60) 21S,OS1, ,100, ,191, (14,SOS,OS4.82) {196,683.77) 190,589, ,461, Summary of Additions Computer Software Easements- Permanent Broadcast Frequency Total Additions Educational & General Designated Funds Auxiliary Enterprises Restricted Expendable Loan Funds Endowment and Similar Unexpended Plant Funds Investment in Plant Funds Gifts Contributions 8,860, ,860, ,001, ,001, ,860, ,001, ,862, \) 0'1 -..j
THE UNIVERSITY OF TEXAS AT EL PASO
THE UNIVERSITY OF TEXAS AT EL PASO ANNUAL FINANCIAL REPORT (WITH DETAILED SUPPORTIVE SCHEDULES) UNAUDITED FISCAL YEAR ENDED AUGUST 31, 2017 The University of Texas at Arlington The University of Texas
More informationHUMBOLDT STATE UNIVERSITY SPONSORED PROGRAMS FOUNDATION
HUMBOLDT STATE UNIVERSITY SPONSORED PROGRAMS FOUNDATION BASIC FINANCIAL STATEMENTS, SUPPLEMENTARY INFORMATION, AND SINGLE AUDIT REPORTS Including Schedules Prepared for Inclusion in the Financial Statements
More informationTHE UNIVERSITY OF TEXAS
THE UNIVERSITY OF TEXAS AT TYLER ANNUAL FINANCIAL REPORT (WITH DETAILED SUPPORTIVE SCHEDULES) UNAUDITED FISCAL YEAR ENDED AUGUST 31, 2017 The University of Texas at Arlington The University of Texas at
More informationLos Angeles Community College District. Report on Audited Basic Financial Statements
Los Angeles Community College District Report on Audited Basic Financial Statements June 30, 2006 June 30, 2006 Los Angeles County, California: East Los Angeles College Los Angeles City College Los Angeles
More informationFinancial statements and report of independent certified public accountants Oklahoma State University June 30, 2006 and 2005
Financial statements and report of independent certified public accountants Oklahoma State University June 30, 2006 and 2005 C O N T E N T S Page MANAGEMENT S DISCUSSION AND ANALYSIS i REPORT OF INDEPENDENT
More informationOMB Circular A-133 Reporting Package. Saginaw Valley State University. Year ended June 30, 2009
OMB Circular A-133 Reporting Package Saginaw Valley State University Year ended June 30, 2009 Saginaw Valley State University OMB Circular A-133 Reporting Package Year ended June 30, 2009 Audited Financial
More informationGEORGIA STATE UNIVERSITY RESEARCH FOUNDATION, INC. AND AFFILIATE (A COMPONENT UNIT OF THE STATE OF GEORGIA)
GEORGIA STATE UNIVERSITY RESEARCH FOUNDATION, INC. AND AFFILIATE (A COMPONENT UNIT OF THE STATE OF GEORGIA) FINANCIAL STATEMENTS AND COMPLIANCE REPORTS For the Year Ended June 30, 2013 GEORGIA STATE UNIVERSITY
More informationNevada System of Higher Education Single Audit Report For the Year Ended June 30, 2011
Nevada System of Higher Education Single Audit Report For the Year Ended June 3, 211 University of Nevada, Reno College of Southern Nevada Western Nevada College University of Nevada, Las Vegas Great Basin
More information16% 11% 18% 30% 17% $ Statutory Tuition. $ Fees. $ Contracts & Grants. $ Sales & Services. $.7 - Investment Income
16% 8% 11% $10.8 - Statutory Tuition $16.0 - Fees $25.7 - Contracts & Grants 30% 18% $25.3 - Sales & Services $.7 - Investment Income $43.5 - State Appropriations 17% $22.6 - Designated Tuition 0% 8% $69.2
More informationUNIVERSITY OF KANSAS CENTER FOR RESEARCH, INC (A Component Unit of the University of Kansas)
UNIVERSITY OF KANSAS CENTER FOR RESEARCH, INC (A Component Unit of the University of Kansas) FINANCIAL STATEMENTS TOGETHER WITH INDEPENDENT AUDITOR S REPORT FOR THE FISCAL YEARS ENDED JUNE 30, 2014 and
More informationUNIVERSITY OF WYOMING BUDGET PRIMER UW Office of Academic Affairs and Budget Office Last update April 2013
UNIVERSITY OF WYOMING BUDGET PRIMER UW Office of Academic Affairs and Budget Office Last update April 2013 This document provides a brief overview of UW s budgets, originally developed for members of the
More informationMassachusetts Life Sciences Center Financial Statements with Management s Discussion and Analysis June 30, 2012 and 2011
Massachusetts Life Sciences Center Financial Statements with Management s Discussion and Analysis Index Page(s) Report of Independent Auditors...1 Management s Discussion and Analysis... 2 5 Financial
More informationIntroduction to WSU Accounting
Introduction to WSU Accounting Presented by Tami Bidle Financial Reporting Manager, Business Services/Controller 5-1202 tbidle@wsu.edu Updated December 2017 Slide 1 Objectives Some history of WSU WSU s
More informationUniversity of Florida Foundation, Inc. Financial and Compliance Report June 30, 2016
University of Florida Foundation, Inc. Financial and Compliance Report Contents Independent auditor s report 1-2 Financial statements Statement of financial position 3 Statement of activities 4 Statement
More informationMICHIGAN STATE UNIVERSITY
MICHIGAN STATE UNIVERSITY FINANCIAL REPORT 2002-2003 SUPPLEMENT: Other Financial Information CONTENTS Consolidating Statement of Net Assets... 4 Consolidating Statement of Revenues, Expenditures and Changes
More informationThe Benefits of Business Behind Bars
ARIZONA CORRECTIONAL INDUSTRIES A DIVISION OF ARIZONA DEPARTMENT OF CORRECTIONS Dear Director Schriro: It is my privilege to present the Arizona Correctional Industries Annual Report for Fiscal Year 2004.
More informationProvince of Newfoundland and Labrador. Report on the Program Expenditures and Revenues of the Consolidated Revenue Fund
Province of Newfoundland and Labrador Report on the Program Expenditures and Revenues of the Consolidated Revenue Fund FOR THE YEAR ENDED MARCH 31, 2017 Province of Newfoundland and Labrador Report on
More information12% 6% 30% 12% 22% $ 8.0 - Statutory Tuition $15.4 - Fees $27.6 - Contracts & Grants $21.6 - Sales & Services $.8 - Investment Income $38.4 - State Appropriations $15.6 - Designated Tuition 1% 17% 10%
More informationFinancial Report Supplement:
Financial Report 2007 2008 Supplement: Other Financial Information CONTENTS Consolidating Statement of Net Assets... 2 Consolidating Statement of Revenues, Expenses, and Changes in Net Assets... 6 Distribution
More informationHENDERSHOT, BURKHARDT & ASSOCIATES CERTIFIED PUBLIC ACCOUNTANTS
Young Marines of the Marine Corps League Financial Statements for the Year Ended September 30, 2016 and Independent Auditors Report Dated March 8, 2017 HENDERSHOT, BURKHARDT & ASSOCIATES CERTIFIED PUBLIC
More informationFINANCIAL REPORT Supplement: Other Financial Information
FINANCIAL REPORT 2005-2006 Supplement: Other Financial Information CONTENTS Consolidating Statement of Net Assets... 2 Consolidating Statement of Revenues, Expenses, and Changes in Net Assets... 6 Distribution
More informationUniversity of Kansas Medical Center Research Institute, Inc.
University of Kansas Medical Center Research Institute, Inc. Independent Auditor s Report and Consolidated Financial Statements June 30, 2017 and 2016 University of Kansas Medical Center Research Institute,
More informationSTATEMENTS OF NET POSITION COLUMBIA. (in thousands of dollars)
2016 Financial Report and Supplemental Schedules 122 STATEMENTS OF NET POSITION COLUMBIA (in thousands of dollars) Fiscal Year Ended June 30, 2016 2015 2014 2013 Assets Current Assets Cash and Cash Equivalents
More informationInstructions for Completing the Annual Plan-Confirmation Statement of Verification Time & Effort Report
Instructions for Completing the Annual Plan-Confirmation Statement of Verification Time & Effort Report To Comply with Federal Cost Principles for Educational Institutions (Uniform Guidance), the Icahn
More informationR0.01 Solicitation and Acceptance of Gifts for the University
21.05.01.R0.01 Solicitation and Acceptance of Gifts for the University Approved September 1, 1996 Revised April 15, 2003 Revised October 28, 2005 Revised May 19, 2010 Revised October 1, 2013 Next Scheduled
More informationProvince of Newfoundland and Labrador. Report on the Program Expenditures and Revenues of the Consolidated Revenue Fund
Province of Newfoundland and Labrador Report on the Program Expenditures and Revenues of the Consolidated Revenue Fund FOR THE YEAR ENDED 31 MARCH 2016 Province of Newfoundland and Labrador Report on the
More informationSTATEMENTS OF NET POSITION
2017 Financial Report and Supplemental Schedules 124 STATEMENTS OF NET POSITION COLUMBIA Fiscal Year Ended June 30, 2017 2016 2015 2014 Assets Current Assets Cash and Cash Equivalents $ 79,785 $ 50,172
More informationUnderstanding F&A THE RESEARCH ADMINISTRATION IMPROVEMENT NETWORK. Presented by. TRAIN at the University of South Florida
Understanding F&A Presented by THE RESEARCH ADMINISTRATION IMPROVEMENT NETWORK Facilities & Administrative (F&A) Costs F&A (or Indirect Costs) are costs that are incurred for common or joint objectives
More informationESTIMATES OF THE PROGRAM EXPENDITURE AND REVENUE OF THE CONSOLIDATED REVENUE FUND
NEWFOUNDLAND AND LABRADOR ESTIMATES OF THE PROGRAM EXPENDITURE AND REVENUE OF THE CONSOLIDATED REVENUE FUND 2008-09 Prepared by The Budgeting Division of the Department of Finance under the direction of
More informationFinance for non-degree granting private, not-for-profit institutions and public institutions using FASB Reporting Standards
2013-14 Survey Materials > Form date: 10/9/2013 Finance for non-degree granting private, not-for-profit institutions and public institutions using FASB Reporting Standards Overview Finance Overview Purpose
More informationUnderstanding F&A THE RESEARCH ADMINISTRATION IMPROVEMENT NETWORK. Presented by. TRAIN at the University of South Florida
Understanding F&A Presented by THE RESEARCH ADMINISTRATION IMPROVEMENT NETWORK Facilities & Administrative (F&A) Costs F&A (or Indirect Costs) are costs that are incurred for common or joint objectives
More informationSTATEMENT OF FINANCIAL POSITION
STATEMENT OF FINANCIAL POSITION TEMPORARILY TOTAL ACCT DESCRIPTION GENERAL RESTRICTED FUNDS CURRENT ASSETS ASSETS 1030 Cash in Bank - Wells Fargo Operating 77,441 77,441 1031 Deposits in transit 1045 First
More informationAnnual Fund Accounting Schedules
Annual Fund Accounting Schedules For the Year Ended June 30, 2013 TABLE OF CONTENTS Former Schedule Identifier Page CURRENT REVENUES, EXPENDITURES AND OTHER CHANGES Statement of Revenues, Expenditures,
More informationhttps://isis.cpb.org/printpage.aspx?printpage=schall
Page 1 of 11 Schedule A NFFS Excluded? If you have an NFFS Exclusion, please click the "NFFS X" button, and enter your NFFS data. Source of Income 2015 data 1. s provided directly by federal government
More informationPOOL ACCOUNT CHART ACCOUNT CODE ACCOUNT TITLE. Page 1 of 6
Page 1 of 6 POOL ACCOUNT CHART POOL ACCOUNT TITLES ACCOUNT CODE ACCOUNT TITLE Pool Account 6100 SALARIES 61001 Salaries Instruction 6100 61002 Instructional Overload/Adjunct 6100 61003 Principal Investigator
More informationFINANCIAL ANALYSIS. Fiscal Year 2017 April 5, of United States Postal Service Financial Results and 10-K Statement
Postal Regulatory Commission Submitted 4/5/2018 2:18:55 PM Filing ID: 104498 Accepted 4/5/2018 Fiscal Year 2017 April 5, 2018 FINANCIAL ANALYSIS of United States Postal Service Financial Results and 10-K
More informationTexas A&M Engineering Experiment Station Expenditures by Category For the Fiscal Year 2013
1 Salaries Salaries - Faculty 1310 Sal-Research - Faculty Equivalent 17,778,901.09 Salaries - Faculty $ 17,778,901.09 Salaries Salaries - Non-Faculty 1110 Sal-Admin - Professional 3,639,432.18 Salaries
More informationLehigh Valley Health Network and Component Entities
Lehigh Valley Health Network and Component Entities Combined Statements of Financial Position (In Thousands) For the periods ended June 30, 2007 and 2006 ASSETS Current assets 2007 2006 Cash and cash equivalents
More informationSTATEMENT OF FINANCIAL POSITION
STATEMENT OF FINANCIAL POSITION TEMPORARILY TOTAL ACCT DESCRIPTION GENERAL RESTRICTED FUNDS CURRENT ASSETS ASSETS 1030 Cash in Bank - Wells Fargo Operating 44,053 44,053 1031 Deposits in transit 1045 First
More informationNew Fund Request System
New Fund Request System The New Fund Request System allows departments to submit requests for new fund codes to be set up, reviewed and approved in an online format. After review and approval the system
More informationESTIMATES OF THE PROGRAM EXPENDITURE AND REVENUE OF THE CONSOLIDATED REVENUE FUND
NEWFOUNDLAND AND LABRADOR ESTIMATES OF THE PROGRAM EXPENDITURE AND REVENUE OF THE CONSOLIDATED REVENUE FUND 2017-18 Prepared by The Department of Finance under the direction of The Honourable Cathy Bennett
More informationOperating Expense Account Codes. Account Code. Description Data Entry FRS subcode
7000 Expenditures Budget only 4000 budget only 7001 DO NOT USE FRS Expenditures Yes 4000/4002/4076/4062 7002 Pcard Clearing Yes Pcard office only 7100 Contractual Services No 7101 Audit Fees Expense Yes
More informationUT Horizon Fund Student Investment Competition (UTHF SIC) 2013
UT Horizon Fund Student Investment Competition (UTHF SIC) 2013 Overview The UT Horizon Fund is hosting the 2 nd annual Student Investment Competition (UTHF SIC). The SIC is a venture creation and investment
More informationAnnual Fund Accounting Schedules
Annual Fund Accounting Schedules For the Year Ended June 30, 2017 TABLE OF CONTENTS Former Schedule Identifier Page CURRENT REVENUES, EXPENDITURES AND OTHER CHANGES Statement of Revenues, Expenditures,
More informationFederal Regulations Governing the Financial Management of National School Lunch / School Breakfast Programs
Federal Regulations Governing the Financial Management of National School Lunch / School Breakfast Programs 7CFR 210.2/ 220.2 Definitions Net cash resources means all monies, as determined in accordance
More informationInternal Control and Compliance Assessment Arkansas Legislative Audit
Internal Control and Compliance Assessment Arkansas Legislative Audit For the Fiscal Year Ended June 30, 2014 INTRODUCTION This report is issued to inform the Legislative Joint Auditing Committee of compliance
More informationAlliance for a Healthier Generation
GaryMcGee & Co. LLP CERTIFIED PUBLIC ACCOUNTANTS Alliance for a Healthier Generation Financial Statements and Other Information as of and for the Years Ended June 30, 2014 and 2013 and Report of Independent
More informationAppendix B: Formulae Used for Calculation of Hospital Performance Measures
Appendix B: Formulae Used for Calculation of Hospital Performance Measures ADJUSTMENTS Adjustment Factor Case Mix Adjustment Wage Index Adjustment Gross Patient Revenue / Gross Inpatient Acute Care Revenue
More informationCentral Louisiana Business Incubator
/^3J^ Central Louisiana Business Incubator (A Program ofthe Alexandria Metropolitan Foundation) Alexandria, Louisiana April 30, 2010 UnccTprovision;", c: State law. tmisiepoilisa puclio document.acopy
More informationMeeting No. 1,146 THE MINUTES OF THE BOARD OF REGENTS THE UNIVERSITY OF TEXAS SYSTEM. Pages 1-413
Meeting No. 1,146 THE MINUTES OF THE BOARD OF REGENTS OF THE UNIVERSITY OF TEXAS SYSTEM Pages 1-413 February 10-11, 2016 Galveston, Texas February 10-11, 2016 Meeting of the U. T. System Board of Regents
More informationCHAPTER 5 Revenues and Other Financing Sources
CHAPTER 5 Revenues and Other Financing Sources Table of Contents Page INTRODUCTION... 1 LIST OF REVENUES AND OTHER FINANCING SOURCES BY FUND... 3 CODING OF REVENUES AND OTHER FINANCING SOURCES... 9 Deductible
More informationSource of Income 2015 data 2016 data
Page 1 of 11 Schedule A NFFS Excluded? If you have an NFFS Exclusion, please click the "NFFS X" button, and enter your NFFS data. Source of Income 2015 data 1. Amounts provided directly by federal government
More informationGREAT PLAINS REGIONAL MEDICAL CENTER UNAUDITED CONSOLIDATED BALANCE SHEET March 31, 2015
1 GREAT PLAINS REGIONAL MEDICAL CENTER UNAUDITED CONSOLIDATED BALANCE SHEET March 31, 2015 ASSETS CURRENT ASSETS: CASH $ 16,545,582 GROSS PATIENT RECEIVABLE 46,060,155 PATIENT RECEIVABLE ALLOWANCES (40,142,691)
More informationPART 34-ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH FOR-PROFIT ORGANIZATIONS. Subpart A-General
PART 34-ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH FOR-PROFIT ORGANIZATIONS 34.1 Purpose. Subpart A-General (a) This part prescribes administrative requirements for awards to for-profit
More informationReturn of Private Foundation
Form 990-PF Return of Private Foundation OMB No. 1545-0052 or Section 4947(a)(1) Trust Treated as Private Foundation 2014 G Do not enter social security numbers on this form as it may be made public. Department
More informationBUDGET REQUEST FOR FISCAL YEAR ENDING JUNE 30, 2019
State of Mississippi Form MBR-1 (2015) a. Additional Compensation b. Proposed Vacancy Rate (Dollar Amount) c. Per Diem Total Salaries, Wages & Fringe Benefits 2. Travel a. Travel & Subsistence (In-State)
More information2007 PROFESSIONAL NURSING SHORTAGE REDUCTION PROGRAM
2007 PROFESSIONAL NURSING SHORTAGE REDUCTION PROGRAM Texas Higher Education Coordinating Board Division of Planning and Accountability P. O. Box 12788 Austin, Texas 78711 (512) 427-6138 http://www.thecb.state.tx.us
More informationRev PARTS I & II TO: PART I - COST REPORT STATUS. 2 ECR Time: 1 ECR Date:
Attachment A New Hospice Medicare Cost Report Forms 08-14 FORM CMS-1984-14 4390 (Cont.) This report is required by law (42 USC 1395g; 42 CFR 413.20(b)). Completion of this report is viewed as a condition
More informationEstimates A Sound Plan, A Secure Future
Estimates 2013 A Sound Plan, A Secure Future NEWFOUNDLAND AND LABRADOR ESTIMATES OF THE PROGRAM EXPENDITURE AND REVENUE OF THE CONSOLIDATED REVENUE FUND 2013-14 Prepared by The Budgeting Division of The
More information10 CFR 600: KNOW YOUR REQUIREMENTS
WEATHERIZATION ASSISTANCE PROGRAM 10 CFR 600: KNOW YOUR REQUIREMENTS Finance can be defined as the art and science of managing money. Virtually all individuals and organizations earn or raise money and
More informationUC San Diego Policy & Procedure Manual
UC San Diego Policy & Procedure Manual Search A Z Index Numerical Index Classification Guide What s New CONTRACTS AND GRANTS (RESEARCH) Section: 150-14 EXHIBIT C Effective: 08/02/2011 Supersedes: 11/01/1998
More informationTABLE OF CONTENTS FOR TECHNOLOGY TRANSFER AND RESEARCH COMMITTEE
TABLE OF CONTENTS FOR TECHNOLOGY TRANSFER AND RESEARCH COMMITTEE Committee Meeting: 5/14/2014 Board Meeting: 5/15/2014 Austin, Texas Wallace L. Hall, Jr., Chairman Ernest Aliseda Alex M. Cranberg R. Steven
More informationThe Fund Maintenance system can be accessed from the WebRaider portal, F&A Work Tools tab, Finance portlet, under Accounting Services.
Fund Maintenance System The Fund Maintenance system allows departments to submit requests for new fund codes to be set up, reviewed and approved. After review and approval, the system will update Banner
More informationESTIMATES OF THE PROGRAM EXPENDITURE AND REVENUE OF THE CONSOLIDATED REVENUE FUND
prosperity balance momentum stewardship leadership growth success forward looking engage ambition action standing strong secure future exploring opportunities responsible balance prosperity momentum stewardship
More informationUNIVERSITY OF HAWAI I SYSTEM ANNUAL REPORT
UNIVERSITY OF HAWAI I SYSTEM ANNUAL REPORT REPORT TO THE 2009 LEGISLATURE Annual Report on University of Hawai i Tuition & Fees Special Fund Expenditures for the Purpose of Generating Private Donations
More informationINCENTIVE$ AND PROGRAM$ OVERVIEW
TEXAS BUSINESS INCENTIVE$ AND PROGRAM$ OVERVIEW TEXAS WIDE OPEN FOR BUSINESS DISCLAIMER: The material contained in this Summary of State Incentives is provided for informational purposes only and cannot
More informationCHART OF ACCOUNTS (COA) INTRODUCTION. Beth A. Meiser
CHART OF ACCOUNTS (COA) INTRODUCTION Beth A. Meiser 1 LEARNING OUTCOMES 1. Understand basic concepts and terminology of Chart of Accounts (COA). 2. Understand the new General Ledger COA structure and how
More informationUnearned revenue Unit 5 page 9, 12 Unsecured note Unit 11 page 12 USChamber.com Unit 6 page 41 Validation rules Unit 8 page 23 Valuation Unit 8 page
Account Unit 3 page 3 Account balance Unit 3 page 5, 6 Accounting concepts (first six) Accounting cycle Unit 5 page 2, 3, 5 Accounting process Unit 4 page 3 Accounts Payable Unit 2 page 14 Unit 11 page
More informationPRINCE GEORGE S COUNTY PUBLIC SCHOOLS. Fiscal Year 2015 Close of Financial Reporting System and Procurement Cut-Off
TO: FROM: BULLETIN PRINCE GEORGE S COUNTY PUBLIC SCHOOLS Chiefs Area Assistant Superintendents Principals Account Managers Chief Financial Officer M - 15-15 Originator s Serial No. March 19, 2015 Date
More informationCHAPTER 5 Revenues and Other Financing Sources
CHAPTER 5 Revenues and Other Financing Sources Table of Contents Section - Page INTRODUCTION 1 1 LIST OF REVENUES AND OTHER FINANCING SOURCES BY FUND 2 1 CODING OF REVENUES AND OTHER FINANCING SOURCES
More informationApplication for Extension of Time To File an
Form 8868 Application for Extension of Time To File an (Rev. January 2014) Exempt Organization Return I OMB No. 1545-1709 Department of the Treasury File a separate application for each return. Internal
More informationFinancial Reporting Main
CPB ISIS Grantee's Main Finance Screen https://isis.cpb.org/headerclick.aspx?rdct=financialmain 1 of 1 4/12/2017 3:16 PM BRUCE HAINES Financial Reporting Legal Forms Grant Payments Grantee Profile Current
More information2014 Department of the Treasury Internal Revenue Service
** PUBLIC DISCLOSURE COPY ** OMB No. 1545-0047 Return of Organization Exempt From Income Tax Form 990 Under section 501(c), 527, or 4947(a)(1) of the Internal Revenue Code (except private foundations)
More informationAccounting for Government Grants
170 Accounting Standard (AS) 12 (issued 1991) Accounting for Government Grants Contents INTRODUCTION Paragraphs 1-3 Definitions 3 EXPLANATION 4-12 Accounting Treatment of Government Grants 5-11 Capital
More informationState Board of Education Fixed Capital Outlay Legislative Budget Request
State Board of Education 2011-12 Fixed Capital Outlay Legislative Budget Request Florida K-20 Education System September 21, 2010 Green Book Page # EDUCATION BUDGET Expenditure Detail Legislative Budget
More informationAnnual results: Net income from ordinary operations increased by 21%
. Annual results 2002 For more information, please contact: Sandra van Campen Phone: +31 20 569 5623 Diemen, February 18, 2003 Annual results: Net income from ordinary operations increased by 21% Highlights
More informationThe University of Alabama
The University of Alabama General Accounting Information and Procedures The purpose of the Accounting Manual is to provide campus with direction and guidance on offices involved in the accounting process,
More informationFY2011 Supplemental Operating Budget
FY2011 Supplemental Operating Budget Total FY2011 University Expenditure Budget Education and General General Fund State $40,796,0 ($4, 130,000) l 36,666,000 Education Legacy Trust 8,041,000 (46,000) 7,995,000
More informationLegislative Appropriations Request
Legislative Appropriations Request For Fiscal Years 2016 and 2017 Submitted to the Governor s Office of Budget, Planning and Policy And the Legislative Budget Board By The University of Houston-Clear Lake
More informationGRAMBLING STATE UNIVERSITY OFFICE OF INSTITUTIONAL ADVANCEMENT GUIDELINES, POLICIES AND PROCEDURES
GRAMBLING STATE UNIVERSITY OFFICE OF INSTITUTIONAL ADVANCEMENT GUIDELINES, POLICIES AND PROCEDURES INTRODUCTION The Grambling State University Foundation known as the Grambling University Foundation was
More informationPage 1 of 6. Preliminary Forecast. Proposed Budget. Preliminary Forecast
Page 1 of 6 Working - Draft #9 - Base Option As of Current SUMMARY Revenue Charges for Current Services 14,244 59,270 91,408 119,533 138,593 152,958 167,842 182,456 Other Local Revenues 1,772,954 1,832,756
More informationA Bill Regular Session, 2017 HOUSE BILL 1213
Stricken language will be deleted and underlined language will be added. 0 State of Arkansas st General Assembly A Bill Regular Session, HOUSE BILL By: Joint Budget Committee For An Act To Be Entitled
More informationAccounting for Government Grants
175 Accounting Standard (AS) 12 (issued 1991) Accounting for Government Grants Contents INTRODUCTION Paragraphs 1-3 Definitions 3 EXPLANATION 4-12 Accounting Treatment of Government Grants 5-11 Capital
More informationESTIMATES OF THE PROGRAM EXPENDITURE AND REVENUE OF THE CONSOLIDATED REVENUE FUND
NEWFOUNDLAND AND LABRADOR ESTIMATES OF THE PROGRAM EXPENDITURE AND REVENUE OF THE CONSOLIDATED REVENUE FUND 2018-19 Prepared by The Department of Finance under the direction of The Honourable Tom Osborne
More informationOther State Allocations for Current Operations (3200) and (3300)
Revenue Codes Revenues received by a local school administrative unit are classified by source of revenue by category and/or purpose within each source. The major sources of revenue are: 1) State; 2) Federal;
More informationCultural Competency Initiative. Program Guidelines
New Jersey STOP Violence Against Women (VAWA) Grants Program Cultural Competency Initiative Cultural Competency Technical Assistance Project Program Guidelines State Office of Victim Witness Advocacy Division
More informationPrinciples of Accounting. ACCT285 [all sections] Southwestern College Professional Studies COURSE SYLLABUS
Principles of Accounting ACCT285 [all sections] Southwestern College Professional Studies COURSE SYLLABUS I. Course Catalog Description This course provides a basic understanding of the financial reporting
More informationNovember 1, Re: Application for calendar 2018 general operating funding
November 1, 2017 Re: Application for calendar 2018 general operating funding The Business Consortium for Arts Support is now accepting applications from eligible South Hampton Roads arts and cultural organizations
More informationOVERVIEW OF OMB SUPERCIRCULAR... 1 OBJECTIVES OF THE REFORM... 1 OMB A-21 (COST PRINCIPLES FOR EDUCATIONAL INSTITUTIONS) TO 2 CFR 200 (UNIFORM ADMIN
Table of Contents OVERVIEW OF OMB SUPERCIRCULAR... 1 OBJECTIVES OF THE REFORM... 1 OMB A-21 (COST PRINCIPLES FOR EDUCATIONAL INSTITUTIONS) TO 2 CFR 200 (UNIFORM ADMIN REQUIREMENTS, COST PRINCIPLES, AND
More informationOperating Expenses ( )
Operating Expenses (0910-0934) 0910 SUPPLIES Office consumables, instructional and laboratory supplies. Includes: purchases less than $1000.00. See object code 0924 Sponsored Project Supplies See object
More informationCSU Auxiliaries 101. CSU 101 October 25-28, 2015 Pismo Beach, CA. Auxiliary Organizations Association. John Griffin
CSU Auxiliaries 101 CSU 101 October 25-28, 2015 Pismo Beach, CA Auxiliary Organizations Association John Griffin 2015 AOA President (Chief Financial Officer, The University Corporation, CSU Northridge)
More informationUniform Guidance vs. OMB Circulars
Program Income Uniform Guidance vs. OMB Circulars Prior to the Uniform Guidance, requirements governing cost Designed for DOL-ETA direct principles, administrative recipients and their requirements and
More information7/1/16 - until amended - 9.1%
Published on UCSF Office of Sponsored Research (https://osr.ucsf.edu) Home > Resources > Facilities and Administrative (F&A) Rates Facilities & Administrative (F&A) Rates Overview The University requires
More informationTAX RETURN FILING INSTRUCTIONS
TA RETURN FILING INSTRUCTIONS ** FORM 990 PUBLIC DISCLOSURE COPY ** FOR THE YEAR ENDING ~~~~~~~~~~~~~~~~~ December 31, 2016 Prepared for Prepared by Amount due or refund Make check payable to Mail tax
More information16233 SOUTH 4BTH ST. PHOENIX, AZ HORIZOHCLC.ORG // CERTIFICATE OF UNAUDITED QUARTERLY FINANCIAL STATEMENTS
HDRfiii'NoRS 16233 SOUTH 4BTH ST. PHOENIX, AZ 85048 HORIZOHCLC.ORG // 480.659.3000 CERTIFICATE OF UNAUDITED QUARTERLY FINANCIAL STATEMENTS The Industrial Development Authority of the County of Maricopa
More informationSEE SCHEDULE O FOR CONTINUATION(S)
Form 990 (2015) ATLANTA, INC. **-***4646 Part III Statement of Program Service Accomplishments Check if Schedule O contains a response or note to any line in this Part III 1 Briefly describe the organization
More informationTable 8.2 FORM CMS County Hospital - Fiscal Year One Worksheet A
Table 8.2 Worksheet A A-6 Reclassified A-8 Net Expenses Salaries Other Total Reclassifications Trial Balance Adjustments For Allocation Cost Center Descriptions 1 2 3 4 5 6 7 General Service Cost Centers
More informationCHAPTER 10 Grant Management
CHAPTER 10 Grant Management Table of Contents Page GRANT MANAGEMENT 1 Introduction... 1 Financial Management of Grants... 1 Planning and Budgeting... 1 Application and Implementation... 2 Monitoring...
More informationForm 990 (2016) ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
Form 990 (2016) II Statement of Program Service Accomplishments 1 2 3 4 4a Check if Schedule O contains a response or note to any line in this II Briefly describe the organization s mission: Best Buddies
More informationBanner Expense Account Codes
Banner Expense Account Codes Account Code Travel 73100 Instate Travel 73110 Instate Professional Development 73200 Out of State Travel 73210 Out of State Professional Devel 73300 Instate Group Travel 73310
More information